RFC1 Antibody (H00005981-M01A)
RFC1 Antibody (3F8)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-A1 antibody, anti-RFC140 antibody, anti-RFC antibody, anti-RECC1 antibody, anti-PO-GA antibody, anti-MHCBFB antibody, anti-MGC51786 antibody, |
|
|
RFC1 Antibody (3F8) Summary: | | Gene: | RFC1 |
|---|
| Purity: | Ascites |
|---|
| Host: | Mouse |
|---|
| | Specificity: | RFC1 - replication factor C (activator 1) 1, 145kDa (3F8) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional RFC1 Products RFC1 Antibody (3F8) Details: | Clone: | 3F8 |
|---|
| Isotype: | IgG2b Kappa |
|---|
| Immunogen: | RFC1 (AAH51786, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | MDIRKFFGVIPSGKKLVSETVKKNEKTKSD EETLKAKKGIKEIKVNSSRKEDDFKQKQPS KKKRIIYDSDSESEETLQVKNAKKPPEKLP VSSKPGKISRQDPVTYISET |
|---|
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.2 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In ascites fluid |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability. [provided by RefSeq]
|
Reviews (0) Related Products (7) Exploring RFC1
|
Jump to: Ask a Question
|
Working with RFC1
RFC1 Antibody (3F8) Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about RFC1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (5)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
