Nuclear Receptor SHP Antibody (H00008431-B01)

Nuclear Receptor SHP Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax

This Product Has Been Discontinued

The Following Alternate Products are Available:

Nuclear Receptor SHP Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:NR0B2
Purity:Whole antisera
Host:Mouse
Specificity:NR0B2 - nuclear receptor subfamily 0, group B, member 2,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional Nuclear Receptor SHP Products
Nuclear Receptor SHP Antibody Details:
Immunogen:NR0B2 (-, 1 a.a. ~ 257 a.a) full-length human protein.
Epitope:MSTSQPGACPCQGAASRPAILYALLSSSLK AVPRPRSRCLCRQHRPVQLCAPHRTCREAL DVLAKTVAFLRNLPSFWQLPPQDQRRLLQG CWGPLFLLGLAQDAVTFEVAEAPVPSILKK ILLEEPSSSGGSGQLPDRPQPSLAAVQWLQ CCLESFWSLELSPKEYACLKGTILFNPDVP GLQAASHIGHLQQEAHWVLCEVLEPWCPAA QGRLTRVLLTASTLKSIPTSLLGDLFFRPI IGDVDIAGLLGDMLL
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:This antibody is in antisera and the concentration is unavailable.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: NR0B2
Entrez8431 (Human)
Swiss ProtAAH30207.1 (Human)
 
Background:

The protein encoded by this gene is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. The gene product is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function. Studies suggest that the protein represses nuclear hormone receptor-mediated transactivation via two separate steps: competition with coactivators and the direct effects of its transcriptional repressor function.

Jump to: Images, Ask a Question

Working with Nuclear Receptor SHP

Nuclear Receptor SHP Antibody Images (1)
Western Blot analysis of NR0B2 expression in transfected 293T cell line by NR0B2 MaxPab polyclonal antibody (B01).

Lane 1: NR0B2 transfected lysate(28.10 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about Nuclear Receptor SHP? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Nuclear Receptor SHP LysateH00008431-T01HuWB(2)

Nuclear Receptor SHP LysateNBL1-13765WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Nuclear Receptor SHP Recombinant ProteinH00008431-P01HuELISA, WB(1)

Primary Antibodies (7)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Nuclear Receptor SHP AntibodyNBP1-33597HuIHC-P, WB(2)

Nuclear Receptor SHP AntibodyNLS5411HuIHC-P(2)

Nuclear Receptor SHP AntibodyNBP1-52816HuWB(1)

Nuclear Receptor SHP AntibodyNBP1-52817HuWB(1)

Nuclear Receptor SHP AntibodyH00008431-B01PHuFunc, WB

... and 2 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Nuclear Receptor SHP RNAiH00008431-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

Nuclear Receptor SHP in Context


Research Areas related to Nuclear Receptor SHP (1):
Novus Explorer for Nuclear Receptor SHP gene

Try our bioinformatic tool that shows the relationships between NR0B2 and other genes, diseases, pathways and post-translational modifications.