| Immunogen | Synthetic peptides corresponding to ABCA12(ATP-binding cassette, sub-family A (ABC1), member 12) The peptide sequence was selected from the middle region of ABCA12.
Peptide sequence TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV. |
| Predicted Species | Mouse (93%), Rat (93%), Canine (100%), Equine (100%), Rabbit (100%), Bovine (93%), Guinea Pig (100%). Backed by our 100% Guarantee. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ABCA12 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against ABCA12 and was validated on Western blot. |
| Theoretical MW | 257 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ABCA12 Antibody (NBP1-69304)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ABCA12 |
![Enzyme Activity Kallikrein 5 [Unconjugated]](https://images.novusbio.com/images2/Kallikrein_5_1108SE_1835.jpg)
