Lipoprotein lipase Antibody (H00004023-B01P)

Lipoprotein lipase Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 mg
 
Bulk Request
Lipoprotein lipase Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:LPL
Purity:Protein A purified
Host:Mouse
Specificity:LPL - lipoprotein lipase,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional Lipoprotein lipase Products
Lipoprotein lipase Antibody Details:
Immunogen:LPL (NP_000228.1, 1 a.a. ~ 475 a.a) full-length human protein.
Epitope:MESKALLVLTLAVWLQSLTASRGGVAAADQ RRDFIDIESKFALRTPEDTAEDTCHLIPGV AESVATCHFNHSSKTFMVIHGWTVTGMYES WVPKLVAALYKREPDSNVIVVDWLSRAQEH YPVSAGYTKLVGQDVARFINWMEEEFNYPL DNVHLLGYSLGAHAAGIAGSLTNKKVNRIT GLDPAGPNFEYAEAPSRLSPDDADFVDVLH TFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ PGCNIGEAIRVIAER
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.05 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: LPL
Entrez4023 (Human)
Swiss ProtNP_000228.1 (Human)
 
Background:

LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with Lipoprotein lipase

Lipoprotein lipase Antibody Images (1)
Western Blot analysis of LPL expression in transfected 293T cell line by LPL MaxPab polyclonal antibody.

Lane 1: LPL transfected lysate(52.25 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about Lipoprotein lipase? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Lipoprotein lipase LysateH00004023-T01HuWB(2)

Lipoprotein lipase LysateNBL1-12656WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Lipoprotein lipase Recombinant ProteinH00004023-P01HuELISA, WB(1)

Primary Antibodies (9)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Lipoprotein lipase AntibodyR-1346-100Bv, HuWB(1)

Lipoprotein lipase AntibodyNBP1-50735Hu, Mu, RtWB(1)

Lipoprotein lipase AntibodyH00004023-D01HuFunc, IP, WB

Lipoprotein lipase AntibodyNBP1-32215HuWB(1)

Lipoprotein lipase Antibody (2C5)NBP1-51565HuELISA, WB(1)

... and 4 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Lipoprotein lipase RNAiH00004023-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

Lipoprotein lipase in Context


Research Areas related to Lipoprotein lipase (1):
Novus Explorer for Lipoprotein lipase gene

Try our bioinformatic tool that shows the relationships between LPL and other genes, diseases, pathways and post-translational modifications.