LXR alpha Antibody (H00010062-A01)
LXR alpha Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-LXR-a antibody, anti-RLD-1 antibody, anti-LXRa antibody, |
|
|
LXR alpha Antibody Summary: | | Gene: | NR1H3 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | nuclear receptor subfamily 1, group H, member 3 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional LXR alpha Products LXR alpha Antibody Details: | Immunogen: | NR1H3 (AAH08819, 1 a.a. ~ 388 a.a) full length recombinant protein with GST tag. |
|---|
| Epitope: | MSLWLGAPVPDIPPDSAVELWKPGAQDASS QAQGGSSCILREEARMPHSAGGTAGVGLEA AEPTALLTRAEPPSEPTEIRPQKRKKGPAP KMLGNELCSVCGDKASGFHYNVLSCEGCKG FFRRSVIKGAHYICHSGGHCPMDTYMRRKC QECRLRKCRQAGMREECVLSEEQIRLKKLK RQEEEQAHATSLPPRASSPPQILPQLSPEQ LGMIEKLVAAQQQCNRRSFSDRLRVTVMLL ETSRRYNPGSESITF |
|---|
Human. Other species not tested. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Reviews (0) Related Products (16) Exploring LXR alpha
|
Jump to: Ask a Question
|
Working with LXR alpha
LXR alpha Antibody Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about LXR alpha? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (10)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
