LXR alpha/NR1H3 Antibody (3D12-C6) Summary
| Immunogen |
NR1H3 (AAH08819, 1 a.a. ~ 388 a.a) full length recombinant protein with GST tag.MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILRE
EARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKR
KKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSV
IKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECV
LSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQ
LGMIEKLVAAQQQCNRRSFSDRLRVTVMLLETSRR |
| Localization |
Nuclear |
| Specificity |
NR1H3 - nuclear receptor subfamily 1, group H, member 3 |
| Isotype |
IgM Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
NR1H3 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
Phosphate buffered saline, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for LXR alpha/NR1H3 Antibody (3D12-C6)
Background
Liver X receptors (LXRs), also known as RLD1, are oxysterol activated nuclear receptors which are involved in the regulation of genesis and metabolism of cholesterols and bile acids. LXRs form heterodimeric complexes with the retinoic acid receptors (RARs) once activated by their respective oxysterol ligands. Two known isoforms, alpha and beta, are differentially expressed; the alpha isoform predominantly expressed in liver, whereas beta isoform expression has been shown to be ubiquitous.
Liver X Receptors (LXRs) are oxysterol activated nuclear receptors which are involved in the regulation of genesis and metabolism of cholesterols and bile acids. LXRs form heterodimeric complexes with the retinoic acid receptors (RARs) once activated by their respective oxysterol ligands. Two known isoforms, alpha and beta, are differentially expressed; the alpha isoform predominantly expressed in liver, whereas beta isoform expression has been shown to be ubiquitous.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Ha, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Publications for LXR alpha/NR1H3 Antibody (H00010062-M01) (0)
There are no publications for LXR alpha/NR1H3 Antibody (H00010062-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LXR alpha/NR1H3 Antibody (H00010062-M01) (0)
There are no reviews for LXR alpha/NR1H3 Antibody (H00010062-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LXR alpha/NR1H3 Antibody (H00010062-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LXR alpha/NR1H3 Products
Research Areas for LXR alpha/NR1H3 Antibody (H00010062-M01)
Find related products by research area.
|
Blogs on LXR alpha/NR1H3