Recombinant Human CCL1/I-309/TCA-3 Protein Summary
| Description |
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 35065 of Human CCL1 full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
CCL1 |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human CCL1/I-309/TCA-3 Protein
Background
This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, Neut
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: Neut, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for CCL1/I-309/TCA-3 Recombinant Protein (H00006346-P01) (0)
There are no publications for CCL1/I-309/TCA-3 Recombinant Protein (H00006346-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CCL1/I-309/TCA-3 Recombinant Protein (H00006346-P01) (0)
There are no reviews for CCL1/I-309/TCA-3 Recombinant Protein (H00006346-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CCL1/I-309/TCA-3 Recombinant Protein (H00006346-P01) (0)
Additional CCL1/I-309/TCA-3 Products
Research Areas for CCL1/I-309/TCA-3 Recombinant Protein (H00006346-P01)
Find related products by research area.
|
Blogs on CCL1/I-309/TCA-3