![Western Blot: HPL-2 Antibody [38630002] - WB analysis of HPL2 in C. elegans lysate. Image courtesy of anonymous customer product review.](http://images.novusbio.com/fullsize/HPL-2-Antibody-Western-Blot-38630002-img0003.jpg "Western Blot: HPL-2 Antibody [38630002] - WB analysis of HPL2 in C. elegans lysate. Image courtesy of anonymous customer product review.")
| Immunogen | In vivo generated recombinant protein fragment |
| Epitope | EDPKDNVFMVEKVLDKRTGKAGRDEFLIQWQGFPESDSSWEPRENLQCVEMLDEFEREFSKREKPIRKRHSQKPEPSEDQADPEEDKDEKKETNQNDKFS |
| Specificity | This antibody is specific to C. elegans HPL2. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HPL2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful in Chromatin Immunoprecipitation, Western Blot, ELISA and Immunofluorescence. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative | No Preservative |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Yogesh Ostwal |
WB | Other | 08/03/2012 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for HPL-2 Antibody (38630002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: HPL-2 Antibody [38630002] - This image is specific to animal number SDQ2340 MeOH/acetone fixation antibody dilution 1:4000](http://images.novusbio.com/fullsize/HPL-2-Antibody-Immunocytochemistry-Immunofluorescence-38630002-img0005.jpg "Immunocytochemistry/Immunofluorescence: HPL-2 Antibody [38630002] - This image is specific to animal number SDQ2340 MeOH/acetone fixation antibody dilution 1:4000")
![Immunocytochemistry/Immunofluorescence: HPL-2 Antibody [38630002] - This image is specific to animal number SDQ2324 MeOH/acetone fixation antibody dilution 1:2000](http://images.novusbio.com/fullsize/HPL-2-Antibody-Immunocytochemistry-Immunofluorescence-38630002-img0004.jpg "Immunocytochemistry/Immunofluorescence: HPL-2 Antibody [38630002] - This image is specific to animal number SDQ2324 MeOH/acetone fixation antibody dilution 1:2000")