Fatty Acid Synthase Antibody (H00002194-B01)
Fatty Acid Synthase Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-Fas antibody, anti-OA-519 antibody, anti-MGC15706 antibody, anti-MGC14367 antibody |
|
|
Fatty Acid Synthase Antibody Summary: | | Gene: | FASN |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | FASN - fatty acid synthase, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Fatty Acid Synthase Products Fatty Acid Synthase Antibody Details: | Immunogen: | FASN (1 a.a. ~ 439 a.a) full-length human protein. |
|---|
| Epitope: | MSTNDTIVSGTLPQRMASCLEVLDLFLNQP HMVLSSFVLAEKAAAYRDRDSQRDLVEAVA HILGIRDLAAVNLDSSLADLGLDSLMSVEV RQTLERELNLVLSVREVRQLTLRKLQELSS KADEASELACPTPKEDGLAQQQTQLNLRSL LVNPEGPTLMRLNSVQSSERPLFLVHPIEG STTVFHSLASRLSIPTYGLQCTRAAPLDSI HSLAAYYIDCIRQVQPEGPYRVAGYSYGAC VAFEMCSQLQAQQSP |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for immunofluorescence and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This antibody is in antisera and the concentration is unavailable. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.
|
Images (3) Reviews (0) Related Products (21) Exploring Fatty Acid Synthase
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (2)Lysates (2)Peptides and ProteinsPrimary Antibodies (13)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Fatty Acid Synthase Antibody | NB400-114 | Ch, Hu, Mk, Mu, Po, Rt | IHC, IHC-P, IP, WB | (3) | (7) | | | | Fatty Acid Synthase Antibody (3F2-1F3) | H00002194-M01 | Hu | ELISA, IF, IHC-P, WB | (4) | (1) | | | | Fatty Acid Synthase Antibody | NB100-87029 | Hu, Mu | IF, IHC-P | (3) | | | | | Fatty Acid Synthase Antibody | NBP1-84733 | Hu | IF, IHC-P, WB | (3) | | | | | Fatty Acid Synthase Antibody | H00002194-B01P | Hu | ELISA, IF, WB | (3) | | | | | ... and 8 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| Fatty Acid Synthase in Context
Research Areas related to Fatty Acid Synthase (1): |
|
Novus Explorer for Fatty Acid Synthase gene
|
|
![Immunofluorescence of <u>purified</u> MaxPab antibody to FASN ( Cat# H00002194-B01 ) on HeLa cell . [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00002194-B01-4-1-1-S.jpg "Immunofluorescence of <u>purified</u> MaxPab antibody to FASN ( Cat# H00002194-B01 ) on HeLa cell . [antibody concentration 10 ug/ml]")
