ERK2 Antibody (H00005594-M01)

ERK2 Antibody (1D1)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
ERK2 Antibody (1D1) Summary:
Species:Hu
Applications:ELISA, IF, WB
Clonality:Monoclonal
Gene:MAPK1
Purity:IgG purified
Host:Mouse
Specificity:MAPK1 - mitogen-activated protein kinase 1
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional ERK2 Products
ERK2 Antibody (1D1) Details:
Clone:1D1
Isotype:IgG1 Kappa
Immunogen:MAPK1 (AAH17832, 261 a.a. ~ 361 a.a) full length recombinant protein with GST tag.
Epitope:RNYLLSLPHKNKVPWNRLFPNADSKALDLL DKMLTFNPHKRIEVEQALAHPYLEQYYDPS DEPIAEAPFKFDMELDDLPKEKLKELIFEE TARFQPGYRS*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Dilutions:ELISA, immunofluorescence, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: MAPK1
Entrez5594 (Human)
OMIM176948 (Human)
Swiss ProtAAH17832 (Human)
 
Background:

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.

Jump to: Images, Ask a Question

Working with ERK2

ERK2 Antibody (1D1) Images (4)
Immunofluorescence of monoclonal antibody to MAPK1 (H00005594-M01) on HeLa cell . [antibody concentration 10 ug/ml]MAPK1 monoclonal antibody (M01), clone 1D1 Western Blot analysis of MAPK1 expression in Hela NE ( Cat # L013V3 ).
Detection limit for recombinant GST tagged MAPK1 is approximately 0.03ng/ml as a capture antibody.Detection limit for recombinant GST tagged MAPK1 is approximately 0.1ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about ERK2? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ERK2 LysateNBL1-12866WB(1)

ERK2 LysateNBL1-12865WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ERK2 ProteinNBP1-30309HuELISA, PAGE(1)

ERK2 Partial Recombinant ProteinH00005594-Q01HuELISA, WB(1)

ERK2 Recombinant ProteinH00005594-P01HuELISA, WB(1)

Primary Antibodies (27)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ERK2 Antibody (9E9)NBP1-47846Hu, RtIHC-P, WB(10)

ERK2 Antibody (6E5)NBP1-47842Ca, Hu, Mk, RtIHC-P, WB(8)

ERK2 Antibody (9H1)NBP1-47845Ca, Hu, Mk, RtIHC-P, WB(6)

ERK2 Antibody (4C2)NBP1-47850Ca, Hu, Mk, RtIF, IHC-P, WB(4)

ERK2 Antibody (E460)NB110-57174Hu, Mu, RtFACS, ICC, IHC-P, IP, WB(2)(2)

... and 22 more. See All »
RNAi (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ERK2 RNAiH00005594-R03Hu(1)(4)

ERK2 RNAiH00005594-R04Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

ERK2 in Context


Research Areas related to ERK2 (8):
Novus Explorer for ERK2 gene

Try our bioinformatic tool that shows the relationships between MAPK1 and other genes, diseases, pathways and post-translational modifications.