ERK1 Antibody (H00005595-M03)

ERK1 Antibody (1E2)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
ERK1 Antibody (1E2) Summary:
Species:Hu
Applications:ELISA, IF, WB
Clonality:Monoclonal
Gene:MAPK3
Purity:IgG purified
Host:Mouse
Specificity:MAPK3 (1E2)
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional ERK1 Products
ERK1 Antibody (1E2) Details:
Clone:1E2
Isotype:IgG2a Kappa
Immunogen:MAPK3 (AAH13992, 279 a.a. ~ 379 a.a) partial recombinant protein with GST tag.
Epitope:NYLQSLPSKTKVAWAKLFPKSDSKALDLLD RMLTFNPNKRITVEEALAHPYLEQYYDPTD EPVAEEPFTFAMELDDLPKERLKELIFQET ARFQPGVLEAP
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Dilutions:ELISA, immunofluorescence, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: MAPK3
Entrez5595 (Human)
OMIM601795, (Human)
Swiss ProtAAH13992 (Human)
 
Background:

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described.

Jump to: Images, Ask a Question

Working with ERK1

ERK1 Antibody (1E2) Images (3)
Immunofluorescence of monoclonal antibody to MAPK3 (H00005595-M03) on HeLa cell . [antibody concentration 10 ug/ml]MAPK3 monoclonal antibody (M03), clone 1E2 Western Blot analysis of MAPK3 expression in HeLa ( Cat # L013V1 ).
Detection limit for recombinant GST tagged MAPK3 is approximately 1ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about ERK1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ERK1 [p Thr202, p Tyr204] Antibody PairDP0113HuPLA(4)

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ERK1 LysateNBL1-12877WB(1)

ERK1 LysateH00005595-T01WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ERK1 ProteinP3875HuFunc, PAGE

ERK1 ProteinNBP1-48333HuELISA, PAGE

ERK1 Recombinant ProteinH00005595-P01HuELISA, WB(1)

ERK1 Partial Recombinant ProteinH00005595-Q01HuELISA, WB(1)

ERK1 ProteinP4224HuFunc, PAGE

Primary Antibodies (36)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ERK1 Antibody (3C9)H00005595-M01HuELISA, IF, IHC-P, WB(5)

ERK1 Antibody (Y72)NB110-56979HuFACS, ICC, IHC-P, IP, WB(2)(1)

ERK1 AntibodyNBP1-84807HuIF, IHC-P, WB(2)

ERK1 AntibodyNBP1-84808HuIF, IHC-P, WB(2)

ERK1 [p Thr202, p Tyr204] AntibodyNB500-141Hu, RtIHC-P, WB(1)

... and 31 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
ERK1 RNAiH00005595-R02Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

ERK1 in Context


Research Areas related to ERK1 (8):
Novus Explorer for ERK1 gene

Try our bioinformatic tool that shows the relationships between MAPK3 and other genes, diseases, pathways and post-translational modifications.