Calponin 2 Antibody

Name: Calponin 2 Antibody
Brand: Novus Biologicals
SKU: NBP1-54341
Price: 329 USD
Availability: Discontinued

Submit a Review

Images

Product Details

Summary

Product Discontinued

Order Details

Catalog Number

NBP1-54341
Availability

Product Discontinued

Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

Or feel free to contact us for alternative products.

Calponin 2 Antibody Summary

Immunogen	Synthetic peptides corresponding to CNN2(calponin 2) The peptide sequence was selected from the N terminal of CNN2. Peptide sequence YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC.
Predicted Species	Mouse (100%), Rat (100%), Canine (100%), Guinea Pig (100%), Bovine (92%). Backed by our 100% Guarantee.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	CNN2
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	Western Blot 0.2-1 ug/ml
Application Notes	This is a rabbit polyclonal antibody against CNN2 and was validated on Western blot.
Theoretical MW	34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 2% Sucrose
Preservative	0.09% Sodium Azide
Purity	Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Calponin 2 Antibody

calponin 2
Calponin H2, smooth muscle
calponin-2
Neutral calponin

Background

CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Connexin 32/GJB1
Antibody (M12.13)

NBP2-53381

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-Fr, WB

FGFR1 Antibody
(M19B2) - BSA Free

NB600-1287

Western Blot FGFR1 Antibody (M19B2) - BSA Free

(1 Review)

(7 Publications)

Species: Ca, Hu, Mu, Rb, Rt

Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB

Presenilin-2
Antibody (APS 26)

NB100-74513

Species: Hu, Mu, Pm, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

IFITM3/Fragilis
Antibody

AF3377

Immunohistochemistry IFITM3/Fragilis Antibody

(6 Publications)

Species: Mu

Applications: IHC, WB

SEPHS1 Antibody -
BSA Free

NBP3-35339

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, WB

p38 alpha Antibody
[Unconjugated]

AF8691

Western Blot p38 alpha Antibody [Unconjugated]

Immunohistochemistry p38 alpha Antibody [Unconjugated]

(1 Review)

(11 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, Simple Western, WB

eEF-2 Antibody
(4E2Z5)

NBP3-16866

Immunocytochemistry/ Immunofluorescence eEF-2 Antibody (4E2Z5)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Vimentin Antibody

NB300-223

Immunohistochemistry-Frozen Vimentin Antibody

(6 Reviews)

(83 Publications)

Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

hnRNP C1 + C2
Antibody (CL2593) - B ...

NBP2-36776

Immunocytochemistry/ Immunofluorescence hnRNP C1 + C2 Antibody (CL2593) - BSA Free

Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593) - BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

SUG1 Antibody -
BSA Free

NBP1-87372

Immunohistochemistry-Paraffin SUG1 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Aconitase 1
Antibody - BSA Free

NBP1-87677

Western Blot Aconitase 1 Antibody - BSA Free

(2 Reviews)

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Lamin A + C
Antibody (mab636)

NB100-74451

(7 Publications)

Species: Bv, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, WB

G protein alpha
Antibody (2A2B7) - BS ...

NBP2-52477

Flow Cytometry G protein alpha Antibody (2A2B7) - BSA Free

Immunohistochemistry G protein alpha Antibody (2A2B7) - BSA Free

(1 Publication)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB

NUDT14 Antibody -
BSA Free

NBP1-92208

Species: Hu

Applications: IHC, IHC-P

TAP2 Antibody -
BSA Free

NBP2-93797

Immunocytochemistry/ Immunofluorescence TAP2 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Caspase-3 Antibody
[Unconjugated] - Acti ...

AF835

Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active

(7 Reviews)

(431 Publications)

Species: Hu, Mu

Applications: ICC, IHC

Flightless I
Antibody - BSA Free

NBP1-87925

(1 Publication)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

FLI1 Antibody -
BSA Free

NBP2-16500

Immunohistochemistry-Paraffin FLI1 Antibody - BSA Free

Species: Hu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for Calponin 2 Antibody (NBP1-54341) (0)

There are no publications for Calponin 2 Antibody (NBP1-54341).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calponin 2 Antibody (NBP1-54341) (0)

There are no reviews for Calponin 2 Antibody (NBP1-54341). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calponin 2 Antibody (NBP1-54341) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional Calponin 2 Products

Blogs on Calponin 2

There are no specific blogs for Calponin 2, but you can read our latest blog posts.

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Calponin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol	CNN2
Uniprot	Q99439(Human)

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Calponin 2 Antibody

Species Glossary

Images

Product Details

Order Details

Calponin 2 Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Calponin 2 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Calponin 2 Antibody (NBP1-54341) (0)

Reviews for Calponin 2 Antibody (NBP1-54341) (0)

Product General Protocols

Video Protocols

FAQs for Calponin 2 Antibody (NBP1-54341) (0)

Secondary Antibodies

Isotype Controls

Additional Calponin 2 Products

Blogs on Calponin 2

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics