ACTRT2 Antibody (H00140625-B01)
ACTRT2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ARPM2 antibody, anti-HARPM2 antibody, anti-FLJ25424 antibody, anti-Arp-T2 antibody, anti-ARPT2 antibody, |
|
|
ACTRT2 Antibody Summary: | | Gene: | ACTRT2 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ACTRT2 - actin-related protein T2, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ACTRT2 Products ACTRT2 Antibody Details: | Immunogen: | ACTRT2 (-, 1 a.a. ~ 377 a.a) full-length human protein. |
|---|
| Epitope: | MFNPHALDSPAVIFDNGSGFCKAGLSGEFG PRHMVSSIVGHLKFQAPSAEANQKKYFVGE EALYKQEALQLHSPFERGLITGWDDVERLW KHLFEWELGVKPSDQPLLATEPSLNPRENR EKMAEVMFENFGVPAFYLSDQAVLALYASA CVTGLVVDSGDAVTCTVPIFEGYSLPHAVT KLHVAGRDITELLMQLLLASGHTFPCQLDK GLVDDIKKKLCYVALEPEKELSRRPEEVLR EYKLPDGNIISLGDP |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this intronless gene belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx.
|
Images (1) Reviews (0) Related Products (14)
|
Jump to: Images, Ask a Question
|
Working with ACTRT2
ACTRT2 Antibody Images (1) Western Blot analysis of ACTRT2 expression in transfected 293T cell line by ACTRT2 MaxPab polyclonal antibody (B01).
Lane 1: ACTRT2 transfected lysate(41.70 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ACTRT2? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (3)Peptides and ProteinsPrimary Antibodies (8)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| ACTRT2 Antibody | NBP1-89005 | Hu | IF, IHC-P, WB | (3) | | | | | ACTRT2 Antibody | NBP1-89006 | Hu | IF, IHC-P, WB | (2) | | | | | ACTRT2 Antibody | NBP1-54626 | Hu, Mu, Rt | WB | (1) | | | | | ACTRT2 Antibody | PAB18827 | Hu, Mu, Rt | ELISA, IHC-P | | | | | | ACTRT2 Antibody | H00140625-D01P | Hu | ELISA, WB | (1) | | | | | ... and 3 more. See All » |
Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| ACTRT2 in Context
|
Novus Explorer for ACTRT2 gene
|
|
