ACTR10 Antibody (H00055860-B01)
ACTR10 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ACTR11 antibody, anti-HARP11 antibody, |
|
|
ACTR10 Antibody Summary: | | Gene: | ACTR10 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ACTR10 - actin-related protein 10 homolog (S. cerevisiae), |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ACTR10 Products ACTR10 Antibody Details: | Immunogen: | ACTR10 (1 a.a. ~ 417 a.a) full-length human protein. |
|---|
| Epitope: | MPLYEGLGSGGEKTAVVIDLGEAFTKCGFA GETGPRCIIPSVIKRAGMPKPVRVVQYNIN TEELYSYLKEFIHILYFRHLLVNPRDRRVV IIESVLCPSHFRETLTRVLFKYFEVPSVLL APSHLMALLTLGINSAMVLDCGYRESLVLP IYEGIPVLNCWGALPLGGKALHKELETQLL EQCTVDTSVAKEQSLPSVMGSVPEGVLEDI KARTCFVSDLKRGLKIQAAKFNIDGNNERP SPPPNVDYPLDGEKI |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (2) Reviews (0) Related Products (6)
|
Jump to: Images, Ask a Question
|
Working with ACTR10
ACTR10 Antibody Images (2) ACTR10 MaxPab polyclonal antibody (B01), Lot # 08007 WULz. Western Blot analysis of ACTR10 expression in rat brain. |  Western Blot analysis of ACTR10 expression in transfected 293T cell line by ACTR10 MaxPab polyclonal antibody (B01).
Lane 1: ACTR10 transfected lysate(46.30 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ACTR10? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (3)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| ACTR10 in Context
|
Novus Explorer for ACTR10 gene
|
|
