ACOX1 Antibody (H00000051-B01)
ACOX1 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ACOX antibody, anti-SCOX antibody, anti-PALMCOX antibody, anti-MGC1198 antibody, |
|
|
ACOX1 Antibody Summary: | | Gene: | ACOX1 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ACOX1 - acyl-Coenzyme A oxidase 1, palmitoyl, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ACOX1 Products ACOX1 Antibody Details: | Immunogen: | ACOX1 (1 a.a. ~ 660 a.a) full-length human protein. |
|---|
| Epitope: | MNPDLRRERDSASFNPELLTHILDGSPEKT RRRREIENMILNDPDFQHEDLNFLTRSQRY EVAVRKSAIMVKKMREFGIADPDEIMWFKN FVHRGRPEPLDLHLGMFLPTLLHQATAEQQ ERFFMPAWNLEIIGTYAQTEMGHGTHLRGL ETIATYDPETQEFILNSPTVTSIKWWPGGL GKTSNHAIVLAQLITKGKCYGLHAFIVPIR EIGTHKPLPGITVGDIGPKFGYDEIDNGYL KMDNHRIPRENMLMK |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against transfected lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500, |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This antibody is in antisera and the concentration is unavailable. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is the first enzyme of the fatty acid beta-oxidation pathway, which catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It donates electrons directly to molecular oxygen, thereby producing hydrogen peroxide. Defects in this gene result in pseudoneonatal adrenoleukodystrophy, a disease that is characterized by accumulation of very long chain fatty acids. Alternatively spliced transcript variants encoding different isoforms have been identified.
|
Images (2) Reviews (0) Related Products (13) Exploring ACOX1
|
Jump to: Images, Ask a Question
|
Working with ACOX1
ACOX1 Antibody Images (2) Immunofluorescence of purified MaxPab antibody to ACOX1 ( Cat# H00000051-B01 ) on HeLa cell . [antibody concentration 10 ug/ml] |  Western Blot analysis of ACOX1 expression in transfected 293T cell line by ACOX1 MaxPab polyclonal antibody (B01).
Lane 1: ACOX1 transfected lysate(74.70 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about ACOX1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (9)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| ACOX1 Antibody | NBP1-80949 | Hu | IF, IHC-P, WB | (1) | | | | | ACOX1 Antibody | NBP1-80950 | Hu | IF, IHC-P, WB | (1) | | | | | ACOX1 Antibody | NBP1-80951 | Hu | IF, IHC-P, WB | (1) | | | | | ACOX1 Antibody | H00000051-B01P | Hu | ELISA, IF, WB | (2) | | | | | ACOX1 Antibody | H00000051-D01 | Hu | Func, IP, WB | | | | | | ... and 4 more. See All » |
RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
