Home » Products » Peptides and Proteins » 14-3-3 eta Protein (NBC1-18397) (0.1 mg)
 

14-3-3 eta Protein (NBC1-18397)

14-3-3 eta Protein

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax

This Product Has Been Discontinued

Please contact customer service for assistance.
(see alternate names)
14-3-3 eta Protein Summary:
Species:Hu
Protein Type:Full length Protein
Applications:WB
Gene:YWHAH
Purity:Protein
Specificity:This protein is from amino acids 1-246
Publications:Antibody has at least 1 Background Reference.
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional 14-3-3 eta Products
LysatesPeptides and Proteins
Primary AntibodiesRNAi
 
» View all 14-3-3 eta Related Products
14-3-3 eta Protein Details:
Immunogen:MGSSHHHHHHSSGLVPRGSHMGDREQLLQR ARLAEQAERYDDMASAMKAVTELNEPLSNE DRNLLSVAYKNVVGARRSSWRVISSIEQKT MADGNEKKLEKVKAYREKIEKELETVCNDV LSLLDKFLIKNCNDFQYESKVFYLKMKGDY YRYLAEVASGEKKNSVVEASEAAYKEAFEI SKEQMQPTHPIRLGLALNFSVFYYEIQNAP EQACLLAKQAFDDAIAELDTLNEDSYKDST LIMQLLRDNLTLWTS
Species Reactivity:

Human.

Applications:
Uses:Useful in Western Blot
Dilutions:Western Blot
Unit Size:0.1 mg
Concentration:1.0 mg/ml
Packaging:
Storage:Store at -80 °C. Avoid freeze-thaw cycles.
Buffer:Liquid in 20mM Tris pH 8.0.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: YWHAH
Swiss ProtNP_003396 (Human)
 
Background:

The 14-3-3 family of proteins plays a key regulatory role in signal transduction, checkpoint control, apoptotic and nutrient-sensing pathways. 14-3-3 proteins are highly conserved and ubiquitously expressed. There are at least seven isoforms, ', ', ', ', ', ' and ' that have been identified in mammals. The 14-3-3' (eta), a subtype of the 14-3-3 family of proteins, was found in B cells, brain, cerebrospinal fluid etc. 14-3-3' interacts with and relocalizes the A20 zinc finger protein from the insoluble to the soluble fraction, suggesting a chaperone function. Recombinant human 14-3-3', fused to His-tag at N-terminus, was expressed in E.coli and purified by conventional chromatography techniques.
Images (1)
  • SDS-Page: 14-3-3 eta Protein [NBC1-18397] - 14-3-3 eta, 30.3 kDa (266 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE

See all images...

Reviews (0)

Be the first to review this product for a reward!

Related Products (9)

1 Lysates

2 Peptides and Proteins

5 Primary Antibodies

1 RNAi

Exploring 14-3-3 eta

2 Related Research Areas

Working with 14-3-3 eta

1 Background References
Jump to: Publications, Images, Ask a Question

Working with 14-3-3 eta

14-3-3 eta Protein Images (1)
SDS-Page: 14-3-3 eta Protein [NBC1-18397] - 14-3-3 eta, 30.3 kDa (266 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.
Publications (1)

14-3-3 eta Protein Background References:

  1. Shigeto Sato., et al. (2006), EMBO. 25, 211?221Chen J., et al. (2007), J Neurosci Res. 85(8):1724-33
Protocols
All General Protocols

Ask a Scientist

Can't find an answer to your question about 14-3-3 eta? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi

Related Products

Lysates (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
14-3-3 eta LysateNBL1-17950WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
14-3-3 eta Partial Recombinant ProteinH00007533-Q01HuELISA, WB(1)

14-3-3 eta ProteinP3524HuPAGE

Primary Antibodies (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
14-3-3 eta Antibody (3G12)NBP1-92691Hu, RtIF, WB(2)(4)

14-3-3 eta AntibodyNB100-65809Bv, Ch, Hu, Mu, Rb, Rt, ShIHC-P, WB(1)(2)

14-3-3 eta Antibody (6A12)H00007533-M04HuELISA, WB(1)

14-3-3 eta AntibodyH00007533-A01HuELISA, WB(1)

14-3-3 eta Antibody (1C2)H00007533-M07HuELISA, WB

RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
14-3-3 eta RNAiH00007533-R01Hu(1)(4)
Jump to: Novus Explorer, Research Areas

14-3-3 eta in Context

Research Areas related to 14-3-3 eta (2):
Novus Explorer for 14-3-3 eta gene
Try our bioinformatic tool that shows the relationships between YWHAH and other genes, diseases, pathways and post-translational modifications.