14-3-3 epsilon Antibody (H00007531-A01)
14-3-3 epsilon Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-14-3-3E antibody, anti-MDS antibody, anti-MDCR antibody, anti-KCIP-1 antibody |
|
|
14-3-3 epsilon Antibody Summary: | | Gene: | YWHAE |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | YWHAE - tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional 14-3-3 epsilon Products 14-3-3 epsilon Antibody Details: | Immunogen: | YWHAE (AAH00179, 1 a.a. ~ 256 a.a) full length recombinant protein with GST tag. |
|---|
| Epitope: | MDDREDLVYQAKLAEQAERYDEMVESMKKV AGMDVELTVEERNLLSVAYKNVIGARRASW RIISSIEQKEENKGGEDKLKMIREYRQMVE TELKLICCDILDVLDKHLIPAANTGESKVF YYKMKGDYHRYLAEFATGNDRKEAAENSLV AYKAASDIAMTELPPTHPIRLGLALNFSVF YYEILNSPDRACRLAKAAFDDAIAELDTLS EESYKDSTLIMQLLRDNLTLWTSDMQGDGE EQNKEALQDVEDENQ |
|---|
Human. Other species not tested. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer.
|
Reviews (0) Related Products (15) Exploring 14-3-3 epsilon
|
Jump to: Ask a Question
|
Working with 14-3-3 epsilon
14-3-3 epsilon Antibody Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about 14-3-3 epsilon? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (8)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| 14-3-3 epsilon Antibody (EPR3919) | NBP1-95309 | Hu, Mu, Rt | FACS, ICC, IF, WB | (2) | | | | | 14-3-3 epsilon Antibody | NBP1-89827 | Hu | IF, IHC-P, WB | (3) | | | | | 14-3-3 epsilon Antibody | NBP1-32695 | Hu | ICC, IF, IHC-P, WB | (3) | | | | | 14-3-3 epsilon Antibody (EPR3918) | NBP1-40780 | Hu, Mu, Rt | FACS, ICC, WB | (2) | | | | | 14-3-3 epsilon Antibody | NB100-92415 | Hu, Mu, Rt | ELISA, WB | (1) | | | | | ... and 3 more. See All » |
RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| 14-3-3 epsilon in Context
Research Areas related to 14-3-3 epsilon (2): |
|
Novus Explorer for 14-3-3 epsilon gene
|
|
