PDGFA Antibody (H00005154-A01)
PDGFA Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-PDGF-A antibody, anti-PDGF1 antibody |
|
|
PDGFA Antibody Summary: | | Gene: | PDGFA |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | PDGFA - platelet-derived growth factor alpha polypeptide |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional PDGFA Products PDGFA Antibody Details: | Immunogen: | PDGFA (-, 84 a.a. ~ 194 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | RKRSIEEAVPAVCKTRTVIYEIPRSQVDPT SANFLIWPPCVEVKRCTGCCNTSSVKCQPS RVHHRSVKVAKVEYVRKKPKLKEVQVRLEE HLECACATTSLNPDYREEDT* |
|---|
Human. Other species not tested. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer or as a heterodimer with the platelet-derived growth factor beta polypeptide, where the dimers are connected by disulfide bonds. Studies using knockout mice have shown cellular defects in oligodendrocytes, alveolar smooth muscle cells, and Leydig cells in the testis; knockout mice die either as embryos or shortly after birth. Two splice variants have been identified for this gene.
|
Reviews (0) Related Products (24) Exploring PDGFA
|
Jump to: Ask a Question
|
Working with PDGFA
PDGFA Antibody Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about PDGFA? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (1)Peptides and ProteinsPrimary Antibodies (10)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| PDGFA Antibody | NB200-633 | Hu, Mu, Rt | IHC-Fr, IHC-P, WB | (2) | | | | | PDGFA Antibody | NBP1-72192 | Hu, Mu, Rt | ELISA, IHC-P, IP, WB | (1) | (1) | | | | PDGFA Antibody | NBP1-19781 | Hu, Mu, Rt | IHC-P, WB | (2) | | | | | PDGFA Antibody | NB600-1382 | Hu, Rt | IF, IHC, WB | (1) | | | | | PDGFA Antibody (MM0013-6D35) | NB110-60979 | Hu | WB | (1) | | | | | ... and 5 more. See All » |
RNAi (4)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
