We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human LIF Protein

Images

 

Product Details

Summary
Product Discontinued
View other related LIF Peptides and Proteins

Order Details


    • Catalog Number
      P3646
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human LIF Protein Summary

Description
A partial recombinant protein corresponding to the amino acids 23 - 202 of Human LIF

Source: Escherichia coli

Amino Acid Sequence:SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Preparation
Method
Escherichia coli expression system
Details of Functionality
The ED50 was determined by the dose-dependent differentiation of M1 myeloid leukemic cells was found to be in the range of 0.01 ng/mL.
Protein/Peptide Type
Recombinant Protein
Gene
LIF

Applications/Dilutions

Dilutions
  • Functional
  • SDS-Page
Application Notes
This product is useful for SDS-PAGE and Functional assays.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
Lyophilized from PBS, pH 4.5
Preservative
No Preservative
Reconstitution Instructions
Reconstitute with deionized water to desired concentration.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LIF Protein

  • CDF
  • D Factor
  • DIA
  • differentiation inhibitory activity
  • differentiation stimulating factor
  • Differentiation-stimulating factor
  • Emfilermin
  • HILDA
  • HILDAcholinergic differentiation factor
  • leukemia inhibitory factor (cholinergic differentiation factor)
  • leukemia inhibitory factor
  • LIF
  • Melanoma-derived LPL inhibitor
  • MLPLI

Background

LIF (leukemia inhibitory factor, myeloid leukemia inhibitory factor) a pleiotropic lymphoid factor was initially described as a factor that inhibits the proliferation of myeloid leukemia cells and induces their differentiation into macrophages. Other activities of LIF include inhibition of adipogenesis, cholinergic neuron differentiation and bone metabolism. Human and mouse LIF share 78% homology and activities of LIF are not species-specific. Human LIF is active on mouse cells, but murine LIF is not active on human cells. Benefits of NovActive® Proteins
Fully Active
-Fully folded naturally by eukaryotic source
-Comparable for eukaryotic glycosylation
BioRisk Free
-animal-free
-serum-free
-endotoxin-free
-infection reagent-free
-low in proteolyic activity
-low in pyrogenic and pro-inflammatory activity
Just reconstitute and add to your cell culture.
Have FDA G.R.A.S. (generally recognized as safe) approval.
Advantages of barley endosperm Folding -Proficient protein machinery, with eukaryotic folding, allows for native formation of the protein and long term protection and storage. Environment -A biochemically inert environment, void of endotoxins, low protease activity and secondary metabolite content, and a simple protein profile, aid in downstream processing in barley. FDA G.R.A.S status -Barley is recognized by the FDA as having G.R.A.S (generally recognized as safe) status.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M6000B
Species: Mu
Applications: ELISA
8475-OM/CF
Species: Hu
Applications: BA
DGP00
Species: Hu
Applications: ELISA
AF-249-NA
Species: Hu
Applications: Neut, WB
257-NT
Species: Hu
Applications: BA
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NBP1-83349
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
D1100
Species: Hu
Applications: ELISA
NBP2-01134
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
255-SC
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
233-FB
Species: Hu
Applications: BA
201-LB
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
203-IL
Species: Hu
Applications: BA
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB

Publications for LIF Recombinant Protein (P3646) (0)

There are no publications for LIF Recombinant Protein (P3646).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIF Recombinant Protein (P3646) (0)

There are no reviews for LIF Recombinant Protein (P3646). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LIF Recombinant Protein (P3646) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LIF Products

Research Areas for LIF Recombinant Protein (P3646)

Find related products by research area.

Blogs on LIF.

Using a STAT3 antibody in chromatin immunoprecipitation (ChIP)
Signal transducer and activator of transcription 3 (STAT3) is an important oncogenic transcriptional factor that mediates tumor induced immune suppression.  Specifically, STAT3 transmits signals from cytokines and growth factor receptors in the pla...  Read full blog post.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LIF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LIF