HDAC6 Antibody (H00010013-A01)
HDAC6 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-HD6 antibody, anti-JM21 antibody |
|
|
HDAC6 Antibody Summary: | | Gene: | HDAC6 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | HDAC6 - histone deacetylase 6 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional HDAC6 Products HDAC6 Antibody Details: | Immunogen: | HDAC6 (NP_006035, 1128 a.a. ~ 1216 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | DVTQPCGDCGTIQENWVCLSCYQVYCGRYI NGHMLQHHGNSGHPLVLSYIDLSAWCYYCQ AYVHHQALLDVKNIAHQNKFGEDMPHPH* |
|---|
Human. Other species not tested. |
| Uses: | This antibody is useful for ELISA. |
|---|
| Dilutions: | ELISA |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription.
|
Reviews (0) Related Products (28) Exploring HDAC6
|
Jump to: Ask a Question
|
Working with HDAC6
HDAC6 Antibody Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about HDAC6? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (20)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| HDAC6 Antibody | NBP1-78981 | Hu | ICC, IF, IHC (-), WB (-) | (1) | | | | | HDAC6 Antibody | NBP1-82212 | Hu | IF, IHC-P, WB | (3) | | | | | HDAC6 Antibody | NB100-91805 | Hu, Mu, Rt | ELISA, IF, IHC-P, WB | (2) | (1) | | | | HDAC6 Antibody | NBP1-61625 | Hu, Mu | ELISA, IF, IHC, WB | (3) | | | | | HDAC6 Antibody (EPR1698(2)) | NBP1-95761 | Hu | ICC, IHC-P, IP, WB | (2) | | | | | ... and 15 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
