BDNF Antibody (H00000627-B01P)
BDNF Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-MGC34632 antibody, anti-Brain-derived neurotrophic factor precursor antibody, anti-Brain-derived neurotrophic factor antibody, anti-Brain-derived neurotrophic factor (Precursor) antibody, anti-Brain-derived antibody, Anti-BDNF antibody, anti-Abrineurin antibody, anti-pro-BDNF antibody, anti-proBDNF antibody, anti-pro Brain-derived neurotrophic factor antibody, anti-pro BDNF antibody, anti-neurotrophin antibody, anti-Neurotrophic antibody, anti-MGC34632 antibody, anti-factor antibody, anti-Brain-derived neurotrophic factor antibody, anti-Brain Derived Neurotrophic Factor antibody, anti-BDNF antibody, anti-antibody, anti-Abrineurin antibody |
|
|
BDNF Antibody Summary: | | Gene: | BDNF |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional BDNF Products BDNF Antibody Details: | Immunogen: | BDNF (AAH29795, 1 a.a. ~ 248 a.a) full-length human protein. |
|---|
| Epitope: | MTILFLTMVISYFGCMKAAPMKEANIRGQG GLAYPGVRTHGTLESVNGPKAGSRGLTSLA DTFEHMIEELLDEDQKVRPNEENNKDADLY TSRVMLSSQVPLEPPLLFLLEEYKNYLDAA NMSMRVRRHSDPARRGELSVCDSISEWVTA ADKKTAVDMSGGTVTVLEKVPVSKGQLKQY FYKTKCNPMGYAKEGCRGIDKRHWNSQCRT TQSYVRALTMDSKKRIGWRFIRIDTSCVCT LTIKRGR* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | ELISA, Western Blot 1:500 |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
| Positive Controls: | 1 Positive Controls |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycaemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Subunit: Monomers and homodimers. Binds to NTRK2/TRKB. Subcellular Location: Secreted protein. Post translation modification: Converted into mature BDNF by plasmin (PLG). Similarity: Belongs to the NGF-beta family.
|
Images (2) Reviews (0) Related Products (45) Exploring BDNF
|
Jump to: Images, Ask a Question
|
Working with BDNF
BDNF Antibody Images (2) Western Blot: BDNF Antibody [H00000627-B01P] - Western Blot analysis of BDNF expression in transfected 293T cell line (H00000627-T01) by BDNF MaxPab polyclonal antibody. Lane 1: BDNF transfected lysate(27.28 KDa). Lane 2: Non-transfected lysate. |  Western Blot: BDNF Antibody [H00000627-B01P] - BDNF MaxPab polyclonal antibody. Western Blot analysis of BDNF expression in NIH/3T3. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about BDNF? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Positive Controls, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPositive ControlsLysates (6)Peptides and ProteinsPrimary Antibodies (17)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| BDNF Antibody | R-088-100 | Hu, Mu, Rt | ELISA, IHC-P, WB | (2) | (10) | | | | BDNF Antibody | R-017-500 | Hu, Mu, Rt | ELISA, IB, IHC-Fr, WB | (1) | (9) | | | | BDNF Antibody | S-016-100 | Hu, Mu, Rt | ELISA, IHC-P, WB | | (7) | | | | BDNF Antibody | S-015-500 | Hu, Rt | ELISA, IHC-P, WB | | (7) | | | | BDNF Antibody | NB100-98682 | Hu, Mu, Rt | IF, IHC-Fr, IHC-P, WB | (2) | (7) | | | | ... and 12 more. See All » |
RNAi (6)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
