- Catalog Number: H00065057-M01A
- Unit Size: 0.1 mg
| Gene ID | 65057 | Reference Sequence | |
| Species Summary | Hu(+) | Application Summary | ELISA, WB |
| Purity | IgG purified | Host | Mouse |
| Clone | 1C11-1A7 |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Background | This gene encodes a protein that is involved in telomere function. This protein is one of six core proteins in the telosome/shelterin telomeric complex, which functions to maintain telomere length and to protect telomere ends. Through its interaction with other components, this protein plays a key role in the assembly and stabilization of this complex, and it mediates the access of telomerase to the telomere. Multiple transcript variants encoding different isoforms have been found for this gene. This gene, which is also referred to as TPP1, is distinct from the unrelated TPP1 gene on chromosome 11, which encodes tripeptidyl-peptidase I. |
| Isotype | IgG1 Kappa |
| Immunogen | ACD (AAH16904, 1 a.a. ~ 545 a.a) full-length recombinant protein with GST tag. |
| Epitope | MPGRCQSDAAMRVNGPASRAPAGWTSGSLHTGPRAGRPRAQARGVRGRGLLLRPRPAKELPLPRKGGAWAPAGNPGPLHPLGVAVGMAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLS |
| Species Reactivity | Human. |
| Uses | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Dilutions |
ELISA, Western Blot 1:500 |
| Packaging | 0.1 mg IgG purified Mouse ascites. |
| Buffer | In 1x PBS, pH 7.2 |
| Preservative | No Preservative |
| Clonality | Monoclonal |
| Alternate Names | anti-24432 antibody, anti-PTOP antibody, anti-Pip1 antibody, anti-TINT1 antibody |
| Notes |
This antibody is supplied by Abnova. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene Symbol | ACD |
|
|


