- Catalog Number: H00053616-B01
- Unit Size: 0.05 ml
| Product Images | ||
|
| Gene ID | 53616 | Reference Sequence | |
| Species Summary | Hu(+) | Application Summary | ELISA, WB |
| Purity | Host | Mouse |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Background | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is highly expressed in the brain and may function as an integrin ligand in the brain. Alternative splicing results in several transcript variants. |
| Immunogen | ADAM22 (-, 1 a.a. ~ 342 a.a) full-length human protein. |
| Epitope | MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSGGEDESRHDALDTRVRGDVGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHIEHGGKTVEVKGGEHCYYQGHIRGNPDSFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYKSRLFEFSLDDLPSEFQQVNITPSKFILKPRPKRSKRQLRRYPRNVEEETKYIELMIVNDHLMFKKH |
| Species Reactivity | Human. |
| Uses | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Dilutions |
Western Blot 1:500 ELISA |
| Packaging | 0.05 ml of mouse antisera with 50% glycerol. |
| Buffer | This antibody is in antisera and the concentration is unavailable. |
| Preservative | No Preservative |
| Alternate Names | anti-MDC2 antibody |
| Notes |
This antibody is supplied by Abnova. The immunizing protein may also available for this product. Unit cost for the protein is $ 250 (2 ug), $ 305 (10 ug), and $ 445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene Symbol | ADAM22 |
|
|



