ACTL7A Antibody
Mouse Polyclonal anti-ACTL7A - actin-like 7A, MaxPab Antibody
Price: $295.00
  • Catalog Number: H00010881-B01
  • Unit Size: 0.05 ml
Product Images
Western Blot analysis of ACTL7A expression in transfected 293T cell line by ACTL7A MaxPab polyclonal antibody (B01).<br><br>Lane 1: ACTL7A transfected lysate(48.60 KDa).<br>Lane 2: Non-transfected lysate.<br> 
Gene ID 10881 Reference Sequence  
Species Summary Hu(+) Application Summary ELISA, WB 
Purity  Host Mouse 
Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background

The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7A), and related gene, ACTL7B, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7A gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. The ACTL7A gene is expressed in a wide variety of adult tissues, however, its exact function is not known.
Research Areas

Chromatin Research,    

Immunogen

ACTL7A (1 a.a. ~ 435 a.a) full-length human protein.
Epitope

MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLG
Species Reactivity

Human. Other species not tested.
Uses

Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions

Western Blot 1:500 ELISA
Packaging

0.05 ml of mouse antisera with 50% glycerol.
Buffer

This antibody is in antisera and the concentration is unavailable.
Preservative

No Preservative
Notes

This antibody is supplied by Abnova. The immunizing protein may also available for this product. Unit cost for the protein is $ 250 (2 ug), $ 305 (10 ug), and $ 445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene Symbol

ACTL7A