IF Antibody
Mouse Polyclonal anti-IF - I factor (complement), MaxPab Antibody
Price: $295.00
  • Catalog Number: H00003426-B01
  • Unit Size: 0.05 ml
Product Images
Western Blot analysis of IF expression in transfected 293T cell line by IF MaxPab polyclonal antibody (B01).<br><br>Lane 1: IF transfected lysate(42.40 KDa).<br>Lane 2: Non-transfected lysate.<br> 
Gene ID 3426 Reference Sequence  
Species Summary Hu(+) Application Summary ELISA, WB 
Purity  Host Mouse 
Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background

This gene encodes a serine proteinase that is essential for regulating the complement cascade. The encoded preproprotein is cleaved to produce both heavy and light chains, which are linked by disulfide bonds to form a heterodimeric glycoprotein. This heterodimer can cleave and inactivate the complement components C4b and C3b, and it prevents the assembly of the C3 and C5 convertase enzymes. Defects in this gene cause complement factor I deficiency, an autosomal recessive disease associated with a susceptibility to pyogenic infections. Mutations in this gene have been associated with a predisposition to atypical hemolytic uraemic syndrome, a disease characterized by acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. Primary glomerulonephritis with immmune deposits is another condition associated with mutation of this gene.
Related Diseases

complement factor I deficiency, atypical hemolytic uraemic syndrome
Immunogen

IF (-, 1 a.a. ~ 377 a.a) full-length human protein.
Epitope

MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELC
Species Reactivity

Human.
Uses

Antibody Reactive Against Tissue Lysate and Transfected Lysate on Western Blot. It has also been used for ELISA.
Dilutions

Western Blot 1:500, ELISA
Packaging

0.05 ml of mouse antisera with 50% glycerol.
Buffer

This antibody is in antisera and the concentration is unavailable.
Preservative

No Preservative
Alternate Names

anti-FI antibody, anti-factor I antibody
Notes

This antibody is supplied by Abnova. The immunizing protein may also available for this product. Unit cost for the protein is $ 250 (2 ug), $ 305 (10 ug), and $ 445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene Symbol

CFI