ADAM2 Antibody
Mouse Polyclonal anti-ADAM2 - ADAM metallopeptidase domain 2 (fertilin beta), MaxPab Antibody
Price: $295.00
  • Catalog Number: H00002515-B01
  • Unit Size: 0.05 ml
Product Images
Western Blot analysis of ADAM2 expression in transfected 293T cell line by ADAM2 MaxPab polyclonal antibody (B01).<br><br>Lane 1: ADAM2 transfected lysate(64.80 KDa).<br>Lane 2: Non-transfected lysate.<br> 
Gene ID 2515 Reference Sequence  
Species Summary Hu(+) Application Summary ELISA, WB 
Purity  Host Mouse 
Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
Immunogen

ADAM2 (-, 1 a.a. ~ 579 a.a) full-length human protein.
Epitope

MWRVLFLLSGLGGLRMDSNFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNLMQKNFLPHNFRVYSYSGTGIMKPLDQDFQNFCHYQGYIEGYPKSVVMVSTCTGLRGVLQFENVSYGIEPLESSVGFEHVIYQVKHKKADVSLYNEKDIESRDLSFKLQSVEHPRTISLESLAVILAQLLSLSMGITYDDINKCQCSGAVCIMNPEAIHFSGVKIFSNCSFEDFAHFISKQKSQCLHNQPRLDPFF
Species Reactivity

Human.
Uses

Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions

Western Blot 1:500 ELISA
Packaging

0.05 ml of mouse antisera with 50% glycerol.
Buffer

This antibody is in antisera and the concentration is unavailable.
Preservative

No Preservative
Alternate Names

anti-CRYN1 antibody, anti-CRYN2 antibody, anti-FTNB antibody, anti-PH-30b antibody, anti-PH30 antibody
Notes

This antibody is supplied by Abnova. The immunizing protein may also available for this product. Unit cost for the protein is $ 250 (2 ug), $ 305 (10 ug), and $ 445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene Symbol

ADAM2