ACOX1 Antibody
Mouse Polyclonal anti-ACOX1 - acyl-Coenzyme A oxidase 1, palmitoyl, MaxPab Antibody
Price: $295.00
  • Catalog Number: H00000051-B01
  • Unit Size: 0.05 ml
Product Images
Western Blot analysis of ACOX1 expression in transfected 293T cell line by ACOX1 MaxPab polyclonal antibody (B01).<br><br>Lane 1: ACOX1 transfected lysate(74.70 KDa).<br>Lane 2: Non-transfected lysate.<br> Immunofluorescence of purified MaxPab antibody to ACOX1 ( Cat# H00000051-B01 ) on HeLa cell . [antibody concentration 10 ug/ml] 
Gene ID 51 Reference Sequence  
Species Summary Hu(+) Application Summary ELISA, IF, WB 
Purity  Host Mouse 
Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background

The protein encoded by this gene is the first enzyme of the fatty acid beta-oxidation pathway, which catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It donates electrons directly to molecular oxygen, thereby producing hydrogen peroxide. Defects in this gene result in pseudoneonatal adrenoleukodystrophy, a disease that is characterized by accumulation of very long chain fatty acids. Alternatively spliced transcript variants encoding different isoforms have been identified.
Research Areas

Lipid and Metabolism,    

Related Diseases

pseudoneonatal adrenoleukodystrophy
Immunogen

ACOX1 (1 a.a. ~ 660 a.a) full-length human protein.
Epitope

MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHEDLNFLTRSQRYEVAVRKSAIMVKKMREFGIADPDEIMWFKNFVHRGRPEPLDLHLGMFLPTLLHQATAEQQERFFMPAWNLEIIGTYAQTEMGHGTHLRGLETIATYDPETQEFILNSPTVTSIKWWPGGLGKTSNHAIVLAQLITKGKCYGLHAFIVPIREIGTHKPLPGITVGDIGPKFGYDEIDNGYLKMDNHRIPRENMLMK
Species Reactivity

Human. Other species not tested.
Uses

Antibody reactive against transfected lysate for Western Blot. Has also been used for immunofluoresence and ELISA.
Dilutions

ELISA, immunofluorescence, Western Blot 1:500
Packaging

0.05 ml of mouse antisera with 50% glycerol.
Buffer

This antibody is in antisera and the concentration is unavailable.
Preservative

No Preservative
Alternate Names

anti-ACOX antibody, anti-MGC1198 antibody, anti-PALMCOX antibody, anti-SCOX antibody
Notes

This antibody is supplied by Abnova. The immunizing protein may also available for this product. Unit cost for the protein is $ 250 (2 ug), $ 305 (10 ug), and $ 445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene Symbol

ACOX1