ZNF79 Antibody (3D12)

Images

 
ELISA: ZNF79 Antibody (3D12) [H00007633-M03] - Detection limit for recombinant GST tagged ZNF79 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF79 Antibody (3D12) Summary

Immunogen
ZNF79 (NP_009066.1, 52 a.a. - 151 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WRCLVSTPRDRFKEGIPGKSRSLVLLGLPVSQPGMNSQLEQREGAWMLEGEDLRSPSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSDLEKSF
Specificity
ZNF79 - zinc finger protein 79 (pT7) (3D12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF79
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF79 Antibody (3D12)

  • pT7
  • zinc finger protein 79 (pT7)
  • zinc finger protein 79
  • ZNFpT7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92892
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02199
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-16197
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13440
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80913
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45966
Species: Hu
Applications: WB, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-32691
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80873
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC

Publications for ZNF79 Antibody (H00007633-M03) (0)

There are no publications for ZNF79 Antibody (H00007633-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF79 Antibody (H00007633-M03) (0)

There are no reviews for ZNF79 Antibody (H00007633-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF79 Antibody (H00007633-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF79 Products

Bioinformatics Tool for ZNF79 Antibody (H00007633-M03)

Discover related pathways, diseases and genes to ZNF79 Antibody (H00007633-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF79 Antibody (H00007633-M03)

Discover more about diseases related to ZNF79 Antibody (H00007633-M03).
 

Pathways for ZNF79 Antibody (H00007633-M03)

View related products by pathway.

Blogs on ZNF79

There are no specific blogs for ZNF79, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF79 Antibody (3D12) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF79
Entrez
Uniprot
COVID-19 update