ZNF692 Antibody

Images

 
Western Blot: ZNF692 Antibody [NBP2-86547] - Host: Rabbit. Target Name: ZNF692. Sample Tissue: Human A549 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF692 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human ZNF692. Peptide sequence: WCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFPPPGEEEGEEEE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF692
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF692 Antibody

  • AICAR responsive element binding protein
  • AREBP
  • FLJ20531
  • Zfp692
  • zinc finger protein 692

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-75610
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF2558
Species: Hu, Mu
Applications: WB, Simple Western

Publications for ZNF692 Antibody (NBP2-86547) (0)

There are no publications for ZNF692 Antibody (NBP2-86547).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF692 Antibody (NBP2-86547) (0)

There are no reviews for ZNF692 Antibody (NBP2-86547). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF692 Antibody (NBP2-86547) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF692 Products

Bioinformatics Tool for ZNF692 Antibody (NBP2-86547)

Discover related pathways, diseases and genes to ZNF692 Antibody (NBP2-86547). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZNF692 Antibody (NBP2-86547)

View related products by pathway.

PTMs for ZNF692 Antibody (NBP2-86547)

Learn more about PTMs related to ZNF692 Antibody (NBP2-86547).

Blogs on ZNF692

There are no specific blogs for ZNF692, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF692 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF692