ZNF404 Antibody


Western Blot: ZNF404 Antibody [NBP1-90916] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: ZNF404 Antibody [NBP1-90916] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: ZNF404 Antibody [NBP1-90916] - Staining of human esophagus shows cytoplasmic positivity in squamous epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ZNF404 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IEFGRQQRPKVGCFSQMIFKKHKSLPLHKRNNTREKSYECKEYKKGFRKYLHLTEHLRDHTGVIPYECN
Specificity of human ZNF404 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF404 Protein (NBP1-90916PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZNF404 Antibody

  • MGC120455
  • zinc finger protein 404


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF404 Antibody (NBP1-90916) (0)

There are no publications for ZNF404 Antibody (NBP1-90916).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF404 Antibody (NBP1-90916) (0)

There are no reviews for ZNF404 Antibody (NBP1-90916). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF404 Antibody (NBP1-90916) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF404 Products

ZNF404 NBP1-90916

Bioinformatics Tool for ZNF404 Antibody (NBP1-90916)

Discover related pathways, diseases and genes to ZNF404 Antibody (NBP1-90916). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF404

There are no specific blogs for ZNF404, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF404 Antibody and receive a gift card or discount.


Gene Symbol ZNF404