ZNF365 Antibody

Images

 
Western Blot: ZNF365 Antibody [NBP1-80000] - Reccomended Titration: 0.2 - 1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate
Immunohistochemistry: ZNF365 Antibody [NBP1-80000] - Human Liver Cellular data: Hepatocyte Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Western Blot: ZNF365 Antibody [NBP1-80000] - Titration: 1.25ug/ml Positive Control: HepG2 Whole Cell.

Product Details

Summary
Product Discontinued
View other related ZNF365 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-80000
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ZNF365 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ZNF365. Peptide sequence DHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKP.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF365
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against ZNF365 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF365 Antibody

  • DKFZp547M223
  • double-stranded RNA-binding zinc finger protein JAZ
  • JAZZfp346
  • Just another zinc finger protein
  • zinc finger protein 346

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01086
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-934
Species: Ba
Applications: WB, ELISA, IP
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NBP1-83671
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF6380
Species: Mu
Applications: WB
MAB2476
Species: Hu
Applications: WB, IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22553
Species: Hu
Applications: WB, ELISA
NBP2-33820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81615
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-545
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-84833
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32106
Species: Hu, Mu
Applications: WB, IP
MAB5175
Species: Mu
Applications: WB, IHC
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF365 Antibody (NBP1-80000) (0)

There are no publications for ZNF365 Antibody (NBP1-80000).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF365 Antibody (NBP1-80000) (0)

There are no reviews for ZNF365 Antibody (NBP1-80000). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF365 Antibody (NBP1-80000) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF365 Antibody (NBP1-80000)

Discover related pathways, diseases and genes to ZNF365 Antibody (NBP1-80000). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF365 Antibody (NBP1-80000)

Discover more about diseases related to ZNF365 Antibody (NBP1-80000).
 

Pathways for ZNF365 Antibody (NBP1-80000)

View related products by pathway.

PTMs for ZNF365 Antibody (NBP1-80000)

Learn more about PTMs related to ZNF365 Antibody (NBP1-80000).

Blogs on ZNF365

There are no specific blogs for ZNF365, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF365 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF365
Uniprot