ZNF365 Antibody


Western Blot: ZNF365 Antibody [NBP1-80000] - Reccomended Titration: 0.2 - 1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate
Immunohistochemistry: ZNF365 Antibody [NBP1-80000] - Human Liver Cellular data: Hepatocyte Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Western Blot: ZNF365 Antibody [NBP1-80000] - Titration: 1.25ug/ml Positive Control: HepG2 Whole Cell.

Product Details

Product Discontinued
View other related ZNF365 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ZNF365 Antibody Summary

Synthetic peptide directed towards the N terminal of human ZNF365. Peptide sequence DHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKP.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against ZNF365 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF365 Antibody

  • DKFZp547M223
  • double-stranded RNA-binding zinc finger protein JAZ
  • JAZZfp346
  • Just another zinc finger protein
  • zinc finger protein 346


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Ba
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF365 Antibody (NBP1-80000) (0)

There are no publications for ZNF365 Antibody (NBP1-80000).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF365 Antibody (NBP1-80000) (0)

There are no reviews for ZNF365 Antibody (NBP1-80000). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF365 Antibody (NBP1-80000) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF365 Antibody (NBP1-80000)

Discover related pathways, diseases and genes to ZNF365 Antibody (NBP1-80000). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF365 Antibody (NBP1-80000)

Discover more about diseases related to ZNF365 Antibody (NBP1-80000).

Pathways for ZNF365 Antibody (NBP1-80000)

View related products by pathway.

PTMs for ZNF365 Antibody (NBP1-80000)

Learn more about PTMs related to ZNF365 Antibody (NBP1-80000).

Blogs on ZNF365

There are no specific blogs for ZNF365, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF365 Antibody and receive a gift card or discount.


Gene Symbol ZNF365