ZNF280D Antibody

Images

 
Western Blot: ZNF280D Antibody [NBP2-86468] - Host: Rabbit. Target Name: ZNF280D. Sample Tissue: Human PANC1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF280D Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human ZNF280D. Peptide sequence: FQLQCHIESTHTPHEFSTICKICELSFETEHVLLQHMKDNHKPGEMPYVC The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF280D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF280D Antibody

  • APAK
  • ATM and p53-associated KZNF protein
  • FLJ32191
  • zinc finger protein 420

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-68766
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-55411
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00006938-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NBP1-85987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-07477
Species: Hu
Applications: WB, Flow, ICC/IF, PA
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
AF1749
Species: Rt
Applications: WB, IHC
NBP2-86468
Species: Hu
Applications: WB

Publications for ZNF280D Antibody (NBP2-86468) (0)

There are no publications for ZNF280D Antibody (NBP2-86468).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF280D Antibody (NBP2-86468) (0)

There are no reviews for ZNF280D Antibody (NBP2-86468). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF280D Antibody (NBP2-86468) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF280D Products

Bioinformatics Tool for ZNF280D Antibody (NBP2-86468)

Discover related pathways, diseases and genes to ZNF280D Antibody (NBP2-86468). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF280D Antibody (NBP2-86468)

Discover more about diseases related to ZNF280D Antibody (NBP2-86468).
 

Pathways for ZNF280D Antibody (NBP2-86468)

View related products by pathway.

Blogs on ZNF280D

There are no specific blogs for ZNF280D, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF280D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF280D