ZNF175 Antibody (1C2) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related ZNF175 Primary Antibodies

Order Details


    • Catalog Number
      H00007728-M01FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ZNF175 Antibody (1C2) [DyLight 680] Summary

Immunogen
ZNF175 (NP_009078, 81 a.a. - 178 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRDGSWCSILEELRLDADRTKKDEQNQIQPMSHSAFFNKKTLNTESNCEYKDP
Specificity
ZNF175 - zinc finger protein 175
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF175
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF175 Antibody (1C2) [DyLight 680]

  • OTK18Zinc finger protein OTK18
  • zinc finger protein 175

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81018
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NBP1-81795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2819
Species: Hu
Applications: WB, ICC
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
H00007728-M01FR
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for ZNF175 Antibody (H00007728-M01FR) (0)

There are no publications for ZNF175 Antibody (H00007728-M01FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF175 Antibody (H00007728-M01FR) (0)

There are no reviews for ZNF175 Antibody (H00007728-M01FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF175 Antibody (H00007728-M01FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF175 Products

Bioinformatics Tool for ZNF175 Antibody (H00007728-M01FR)

Discover related pathways, diseases and genes to ZNF175 Antibody (H00007728-M01FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF175 Antibody (H00007728-M01FR)

Discover more about diseases related to ZNF175 Antibody (H00007728-M01FR).
 

Pathways for ZNF175 Antibody (H00007728-M01FR)

View related products by pathway.

PTMs for ZNF175 Antibody (H00007728-M01FR)

Learn more about PTMs related to ZNF175 Antibody (H00007728-M01FR).

Blogs on ZNF175

There are no specific blogs for ZNF175, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF175 Antibody (1C2) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF175