ZNF174 Antibody (2D7-E9.) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related ZNF174 Primary Antibodies

Order Details


    • Catalog Number
      H00007727-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ZNF174 Antibody (2D7-E9.) [DyLight 405] Summary

Immunogen
ZNF174 (AAH00876, 1 a.a. - 234 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTELLIEKTDPNMATDELPCKLWLSFIA
Localization
Nuclear
Specificity
ZNF174 - zinc finger protein 174
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF174
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 405
Format
DyLight 405 (A=400, E=420)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF174 Antibody (2D7-E9.) [DyLight 405]

  • AW-1
  • zinc finger protein 174
  • ZSCAN8Zinc finger and SCAN domain-containing protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00051282-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-38425
Species: Hu
Applications: IHC, IHC-P
NBP1-76669
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-81760
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-27561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-82605
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, IHC
AF4309
Species: Mu
Applications: WB, IHC, ICC
NBP1-82840
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
NBP2-20970
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45628
Species: Hu
Applications: WB, IHC
H00007727-M01V
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for ZNF174 Antibody (H00007727-M01V) (0)

There are no publications for ZNF174 Antibody (H00007727-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF174 Antibody (H00007727-M01V) (0)

There are no reviews for ZNF174 Antibody (H00007727-M01V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF174 Antibody (H00007727-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF174 Antibody (2D7-E9.) [DyLight 405] Products

Related Products by Gene

Bioinformatics Tool for ZNF174 Antibody (H00007727-M01V)

Discover related pathways, diseases and genes to ZNF174 Antibody (H00007727-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF174 Antibody (H00007727-M01V)

Discover more about diseases related to ZNF174 Antibody (H00007727-M01V).
 

Pathways for ZNF174 Antibody (H00007727-M01V)

View related products by pathway.

PTMs for ZNF174 Antibody (H00007727-M01V)

Learn more about PTMs related to ZNF174 Antibody (H00007727-M01V).

Blogs on ZNF174

There are no specific blogs for ZNF174, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our ZNF174 Antibody (2D7-E9.) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF174