Recombinant Human ZMYM6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZMYM6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-156 of Human ZMYM6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKEPLDGECGKAVVPQQELLDKIKEEPDNAQEYGCVQQPKTQESKLKIGGVSSVNERPIAQQLNPGFQLSFASSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYHKTGSTQLFCSTRCITRHSSPACLPPPPKKTCTNCSKYKILNIPFYFTFF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZMYM6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZMYM6 Protein

  • Buster2
  • KIAA1353
  • MYM
  • MYM-type containing 6
  • zinc finger MYM-type protein 6
  • zinc finger, MYM-type 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-13551
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13550
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-458
Species: Hu
Applications: WB, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00011116-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82196
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-20849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81929
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00057804-M01A
Species: Hu
Applications: WB, ELISA
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
H00009204-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZMYM6 Recombinant Protein (H00009204-P01) (0)

There are no publications for ZMYM6 Recombinant Protein (H00009204-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZMYM6 Recombinant Protein (H00009204-P01) (0)

There are no reviews for ZMYM6 Recombinant Protein (H00009204-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZMYM6 Recombinant Protein (H00009204-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZMYM6 Products

Bioinformatics Tool for ZMYM6 Recombinant Protein (H00009204-P01)

Discover related pathways, diseases and genes to ZMYM6 Recombinant Protein (H00009204-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZMYM6

There are no specific blogs for ZMYM6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Glut1 Antibody
NB110-39113
ZMYM6 Antibody
NBP1-80053

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZMYM6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZMYM6