Zic2 Antibody (3H7)

Images

 
There are currently no images for Zic2 Antibody (H00007546-M08).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3H7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Zic2 Antibody (3H7) Summary

Immunogen
ZIC2 (NP_009060, 130 a.a. - 220 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMN
Specificity
ZIC2 (3H7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZIC2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Zic2 Antibody (3H7)

  • HPE5Zic family member 2 (odd-paired Drosophila homolog)
  • Zic family member 2 (odd-paired homolog, Drosophila)
  • Zinc finger protein of the cerebellum 2
  • zinc finger protein ZIC 2

Background

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This protein functions as a transcriptional repressor and may regulate tissue specific expression of dopamine receptor D1. Mutations in this gene cause holoprosencephaly type 5. Holoprosencephaly is the most common structural anomaly of the human brain. A polyhistidine tract polymorphism in this gene may be associated with increased risk of neural tube defects. This gene is closely linked to a gene encoding zinc finger protein of the cerebellum 5, a related family member on chromosome 13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-488
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7555
Species: Hu
Applications: WB, Simple Western
H00006496-M04
Species: Hu
Applications: WB, ELISA
AF5310
Species: Hu, Mu
Applications: WB, ICC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-50469
Species: Hu, Mk, Pm
Applications: WB (-), ELISA, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
423-F8/CF
Species: Hu, Mu
H00084107-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF2400
Species: Hu
Applications: WB, ChIP, ICC
AF2569
Species: Hu
Applications: WB, ICC
H00007546-M08
Species: Hu
Applications: WB, ELISA

Publications for Zic2 Antibody (H00007546-M08) (0)

There are no publications for Zic2 Antibody (H00007546-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zic2 Antibody (H00007546-M08) (0)

There are no reviews for Zic2 Antibody (H00007546-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Zic2 Antibody (H00007546-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Zic2 Products

Bioinformatics Tool for Zic2 Antibody (H00007546-M08)

Discover related pathways, diseases and genes to Zic2 Antibody (H00007546-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Zic2 Antibody (H00007546-M08)

Discover more about diseases related to Zic2 Antibody (H00007546-M08).
 

Pathways for Zic2 Antibody (H00007546-M08)

View related products by pathway.

PTMs for Zic2 Antibody (H00007546-M08)

Learn more about PTMs related to Zic2 Antibody (H00007546-M08).
 

Research Areas for Zic2 Antibody (H00007546-M08)

Find related products by research area.

Blogs on Zic2

There are no specific blogs for Zic2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Zic2 Antibody (3H7) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZIC2
Entrez
OMIM
Uniprot