ZIC1 Antibody (2F6)


Western Blot: ZIC1 Antibody (2F6) [H00007545-M11] - Analysis of ZIC1 expression in IMR-32.

Product Details

Product Discontinued
View other related ZIC1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ZIC1 Antibody (2F6) Summary

ZIC1 (NP_003403, 139 a.a. - 212 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGAGA
Ectoderm Marker
ZIC1 (2F6)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZIC1 Antibody (2F6)

  • Zic family member 1 (odd-paired homolog, Drosophila)
  • ZIC1
  • ZICZic family member 1 (odd-paired Drosophila homolog)
  • Zinc finger protein 201
  • Zinc finger protein of the cerebellum 1
  • ZNF201
  • ZNF201zinc finger protein ZIC 1


This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
Species: Hu, Mu
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
Species: Hu, Mk, Pm
Applications: WB (-), ELISA, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
Species: Mu
Applications: WB, IHC

Publications for ZIC1 Antibody (H00007545-M11) (0)

There are no publications for ZIC1 Antibody (H00007545-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZIC1 Antibody (H00007545-M11) (0)

There are no reviews for ZIC1 Antibody (H00007545-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZIC1 Antibody (H00007545-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZIC1 Products

Bioinformatics Tool for ZIC1 Antibody (H00007545-M11)

Discover related pathways, diseases and genes to ZIC1 Antibody (H00007545-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZIC1 Antibody (H00007545-M11)

Discover more about diseases related to ZIC1 Antibody (H00007545-M11).

Pathways for ZIC1 Antibody (H00007545-M11)

View related products by pathway.

PTMs for ZIC1 Antibody (H00007545-M11)

Learn more about PTMs related to ZIC1 Antibody (H00007545-M11).

Research Areas for ZIC1 Antibody (H00007545-M11)

Find related products by research area.

Blogs on ZIC1

There are no specific blogs for ZIC1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZIC1 Antibody (2F6) and receive a gift card or discount.


Gene Symbol ZIC1