ZHX2 Antibody (5E2)

Images

 
Western Blot: ZHX2 Antibody (5E2) [H00022882-M01] - Analysis of ZHX2 over-expressed 293 cell line, cotransfected with ZHX2 Validated Chimera RNAi ( Cat # H00022882-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Immunocytochemistry/ Immunofluorescence: ZHX2 Antibody (5E2) [H00022882-M01] - Analysis of monoclonal antibody to ZHX2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: ZHX2 Antibody (5E2) [H00022882-M01] - Analysis of monoclonal antibody to ZHX2 on formalin-fixed paraffin-embedded human smooth muscle. Antibody concentration 3 ug/ml.
Western Blot: ZHX2 Antibody (5E2) [H00022882-M01] - Analysis of ZHX2 expression in transfected 293T cell line by ZHX2 monoclonal antibody (M01), clone 5E2.Lane 1: ZHX2 transfected lysate(92.307 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
Clone
5E2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZHX2 Antibody (5E2) Summary

Immunogen
ZHX2 (NP_055758, 691 a.a. ~ 788 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEES
Localization
Nuclear
Specificity
ZHX2 - zinc fingers and homeoboxes 2
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZHX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
Application Notes
Antibody reactive against recominant protein and transfected lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), RNAi validation, and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZHX2 Antibody (5E2)

  • zona pellucida glycoprotein 2 (sperm receptor)
  • Zona pellucida glycoprotein 2
  • zona pellucida glycoprotein ZP2
  • Zona pellucida protein A
  • zona pellucida sperm-binding protein 2
  • Zp-2
  • ZPA

Background

The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This gene encodes member 2 of this gene family. In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-67358
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94255
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47668
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-33116
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00022882-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi

Publications for ZHX2 Antibody (H00022882-M01) (0)

There are no publications for ZHX2 Antibody (H00022882-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZHX2 Antibody (H00022882-M01) (0)

There are no reviews for ZHX2 Antibody (H00022882-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZHX2 Antibody (H00022882-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZHX2 Products

Bioinformatics Tool for ZHX2 Antibody (H00022882-M01)

Discover related pathways, diseases and genes to ZHX2 Antibody (H00022882-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZHX2 Antibody (H00022882-M01)

Discover more about diseases related to ZHX2 Antibody (H00022882-M01).
 

Pathways for ZHX2 Antibody (H00022882-M01)

View related products by pathway.

PTMs for ZHX2 Antibody (H00022882-M01)

Learn more about PTMs related to ZHX2 Antibody (H00022882-M01).
 

Research Areas for ZHX2 Antibody (H00022882-M01)

Find related products by research area.

Blogs on ZHX2

There are no specific blogs for ZHX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZHX2 Antibody (5E2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZHX2
Entrez
OMIM
Uniprot