ZG16 Antibody

Images

 
Western Blot: ZG16 Antibody [NBP2-30488] - Analysis in control (vector only transfected HEK293T lysate) and ZG16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30488] - Staining of human testis.
Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30488] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30488] - Staining of human rectum shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30488] - Staining in human rectum and liver tissues using anti-ZG16 antibody. Corresponding ZG16 RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30488] - Staining of human colon, liver, rectum and testis using Anti-ZG16 antibody NBP2-30488 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: ZG16 Antibody [NBP2-30488] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZG16 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZG16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZG16 Protein (NBP2-30488PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZG16 Antibody

  • hZG16
  • JCLN
  • JCLN1
  • MGC34820
  • ZG16A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49089
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45628
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1640
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00006690-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-30488
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZG16 Antibody (NBP2-30488) (0)

There are no publications for ZG16 Antibody (NBP2-30488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZG16 Antibody (NBP2-30488) (0)

There are no reviews for ZG16 Antibody (NBP2-30488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZG16 Antibody (NBP2-30488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZG16 Products

Bioinformatics Tool for ZG16 Antibody (NBP2-30488)

Discover related pathways, diseases and genes to ZG16 Antibody (NBP2-30488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZG16 Antibody (NBP2-30488)

Discover more about diseases related to ZG16 Antibody (NBP2-30488).
 

Pathways for ZG16 Antibody (NBP2-30488)

View related products by pathway.

Blogs on ZG16

There are no specific blogs for ZG16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZG16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZG16
Uniprot