Recombinant Human ZFP37 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZFP37 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 193-288 of Human ZFP37 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HSRNCVKRKSDAAKEHKKSFNHSLSDTRKGKKQTGKKHEKLSSHSSSDKCNKTGKKHDKLCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQA

Protein/Peptide Type
Partial Recombinant Protein
Gene
ZFP37

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZFP37 Protein

  • dJ734P14.5
  • FLJ39592
  • MGC10715
  • MGC20504
  • zinc finger protein 343

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF5510
Species: Hu
Applications: WB
MAB5809
Species: Hu
Applications: WB
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-48700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-02316
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
H00007539-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZFP37 Partial Recombinant Protein (H00007539-Q01) (0)

There are no publications for ZFP37 Partial Recombinant Protein (H00007539-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP37 Partial Recombinant Protein (H00007539-Q01) (0)

There are no reviews for ZFP37 Partial Recombinant Protein (H00007539-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFP37 Partial Recombinant Protein (H00007539-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZFP37 Products

Bioinformatics Tool for ZFP37 Partial Recombinant Protein (H00007539-Q01)

Discover related pathways, diseases and genes to ZFP37 Partial Recombinant Protein (H00007539-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP37 Partial Recombinant Protein (H00007539-Q01)

Discover more about diseases related to ZFP37 Partial Recombinant Protein (H00007539-Q01).
 

Pathways for ZFP37 Partial Recombinant Protein (H00007539-Q01)

View related products by pathway.

Blogs on ZFP37

There are no specific blogs for ZFP37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZFP37 Antibody
NBP2-13546

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZFP37 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFP37