Recombinant Human ZFP36L1 Protein

Images

 
SDS-Page: Recombinant Human ZFP36L1 Protein [H00000677-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZFP36L1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-108 of Human ZFP36L1

Source: Wheat Germ

Amino Acid Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGG

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZFP36L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZFP36L1 Protein

  • ZBRK1KRAB zinc finger protein ZFQR
  • ZFQR
  • Zinc finger and BRCA1-interacting protein with a KRAB domain 1
  • zinc finger protein 350
  • Zinc finger protein ZBRK1
  • zinc-finger protein ZBRK1

Background

ZFP36L1 - zinc finger protein 36, C3H type-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
H00055814-R01
Species: Hu
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
H00026469-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-60657
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-61418
Species: Hu
Applications: WB
H00009617-B01P
Species: Hu
Applications: WB, ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85123
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for ZFP36L1 Partial Recombinant Protein (H00000677-Q01) (0)

There are no publications for ZFP36L1 Partial Recombinant Protein (H00000677-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP36L1 Partial Recombinant Protein (H00000677-Q01) (0)

There are no reviews for ZFP36L1 Partial Recombinant Protein (H00000677-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFP36L1 Partial Recombinant Protein (H00000677-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ZFP36L1 Partial Recombinant Protein (H00000677-Q01)

Discover related pathways, diseases and genes to ZFP36L1 Partial Recombinant Protein (H00000677-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP36L1 Partial Recombinant Protein (H00000677-Q01)

Discover more about diseases related to ZFP36L1 Partial Recombinant Protein (H00000677-Q01).
 

Pathways for ZFP36L1 Partial Recombinant Protein (H00000677-Q01)

View related products by pathway.

PTMs for ZFP36L1 Partial Recombinant Protein (H00000677-Q01)

Learn more about PTMs related to ZFP36L1 Partial Recombinant Protein (H00000677-Q01).

Blogs on ZFP36L1

There are no specific blogs for ZFP36L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZFP36L1 Antibody
NBP1-88667

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZFP36L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFP36L1