ZFP36L1 Antibody

Images

 
Immunohistochemistry-Paraffin: ZFP36L1 Antibody [NBP1-88667] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZFP36L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZFP36L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZFP36L1 Protein (NBP1-88667PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZFP36L1 Antibody

  • ZBRK1KRAB zinc finger protein ZFQR
  • ZFQR
  • Zinc finger and BRCA1-interacting protein with a KRAB domain 1
  • zinc finger protein 350
  • Zinc finger protein ZBRK1
  • zinc-finger protein ZBRK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
H00055814-R01
Species: Hu
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
AF4245
Species: Hu
Applications: WB, IP
H00026469-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-60657
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P, PLA
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47442
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009617-B01P
Species: Hu
Applications: WB, ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85123
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP

Publications for ZFP36L1 Antibody (NBP1-88667) (0)

There are no publications for ZFP36L1 Antibody (NBP1-88667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP36L1 Antibody (NBP1-88667) (0)

There are no reviews for ZFP36L1 Antibody (NBP1-88667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZFP36L1 Antibody (NBP1-88667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFP36L1 Products

Bioinformatics Tool for ZFP36L1 Antibody (NBP1-88667)

Discover related pathways, diseases and genes to ZFP36L1 Antibody (NBP1-88667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP36L1 Antibody (NBP1-88667)

Discover more about diseases related to ZFP36L1 Antibody (NBP1-88667).
 

Pathways for ZFP36L1 Antibody (NBP1-88667)

View related products by pathway.

PTMs for ZFP36L1 Antibody (NBP1-88667)

Learn more about PTMs related to ZFP36L1 Antibody (NBP1-88667).

Blogs on ZFP36L1

There are no specific blogs for ZFP36L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFP36L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFP36L1