Recombinant Human ZFP200 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZFP200 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 192-290 of Human ZNF200 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VSQQPPDNQEKERLNTSIPQKRKMRNLLVTIENDTPLEELSKYVDISIIALTRNRRTRRWYTCPLCGKQFNESSYLISHQRTHTGEKPYDCNHCGKSFN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF200
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZFP200 Protein

  • MGC45293
  • zinc finger protein 200
  • ZNFMF

Background

ZNF200 - zinc finger protein 200

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-80604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBL1-11569
Species: Hu
NBP2-10888
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP2-45893
Species: Hu
Applications: WB, IHC
NBP1-88509
Species: Hu
Applications: WB, IHC, IHC-P
AF3430
Species: Hu
Applications: WB, ICC
NBP1-71867
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
H00007752-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZFP200 Partial Recombinant Protein (H00007752-Q01) (0)

There are no publications for ZFP200 Partial Recombinant Protein (H00007752-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP200 Partial Recombinant Protein (H00007752-Q01) (0)

There are no reviews for ZFP200 Partial Recombinant Protein (H00007752-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFP200 Partial Recombinant Protein (H00007752-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZFP200 Products

Bioinformatics Tool for ZFP200 Partial Recombinant Protein (H00007752-Q01)

Discover related pathways, diseases and genes to ZFP200 Partial Recombinant Protein (H00007752-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP200 Partial Recombinant Protein (H00007752-Q01)

Discover more about diseases related to ZFP200 Partial Recombinant Protein (H00007752-Q01).

Blogs on ZFP200

There are no specific blogs for ZFP200, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZFP200 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF200