Recombinant Human ZFP161 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ZFP161 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 311-420 of Human ZFP161

Source: Wheat Germ

Amino Acid Sequence: TKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZFP161
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZFP161 Protein

  • hZF5
  • ZBTB14MGC126126
  • ZF5zfp-5
  • Zfp-161
  • Zfp-5
  • Zinc finger and BTB domain-containing protein 14
  • zinc finger protein 161 homolog (mouse)
  • zinc finger protein 161 homolog
  • Zinc finger protein 478
  • Zinc finger protein 5 homolog
  • zinc finger protein homologous to Zfp161 in mouse
  • ZNF478zfp-161

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-76519
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, ICC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-30682
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36064
Species: Hu
Applications: WB, IHC-Fr
NBP1-86460
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1687
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-54719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33931
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80115
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
AF4937
Species: Hu
Applications: WB, IHC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00007541-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ZFP161 Partial Recombinant Protein (H00007541-Q01) (0)

There are no publications for ZFP161 Partial Recombinant Protein (H00007541-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP161 Partial Recombinant Protein (H00007541-Q01) (0)

There are no reviews for ZFP161 Partial Recombinant Protein (H00007541-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFP161 Partial Recombinant Protein (H00007541-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZFP161 Products

Bioinformatics Tool for ZFP161 Partial Recombinant Protein (H00007541-Q01)

Discover related pathways, diseases and genes to ZFP161 Partial Recombinant Protein (H00007541-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP161 Partial Recombinant Protein (H00007541-Q01)

Discover more about diseases related to ZFP161 Partial Recombinant Protein (H00007541-Q01).
 

Pathways for ZFP161 Partial Recombinant Protein (H00007541-Q01)

View related products by pathway.

PTMs for ZFP161 Partial Recombinant Protein (H00007541-Q01)

Learn more about PTMs related to ZFP161 Partial Recombinant Protein (H00007541-Q01).

Blogs on ZFP161

There are no specific blogs for ZFP161, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
ZFP161 Antibody (4F7)
H00007541-M02
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZFP161 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFP161