ZFP161 Antibody

Images

 
Western Blot: ZFP161 Antibody [H00007541-B01P] - Analysis of ZFP161 expression in transfected 293T cell line by ZFP161 polyclonal antibody. Lane 1: ZFP161 transfected lysate(49.39 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: ZFP161 Antibody [H00007541-B01P] - Analysis of purified antibody to ZFP161 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZFP161 Antibody Summary

Immunogen
ZFP161 (NP_003400.2, 1 a.a. - 449 a.a.) full-length human protein. MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS
Specificity
ZFP161 - zinc finger protein 161 homolog (mouse),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ZFP161
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZFP161 Antibody

  • hZF5
  • ZBTB14MGC126126
  • ZF5zfp-5
  • Zfp-161
  • Zfp-5
  • Zinc finger and BTB domain-containing protein 14
  • zinc finger protein 161 homolog (mouse)
  • zinc finger protein 161 homolog
  • Zinc finger protein 478
  • Zinc finger protein 5 homolog
  • zinc finger protein homologous to Zfp161 in mouse
  • ZNF478zfp-161

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-76519
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, ICC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-30682
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36064
Species: Hu
Applications: WB, IHC-Fr
NBP1-86460
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1687
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-54719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3756
Species: Hu, Mu, Rt
Applications: WB
NBP1-80115
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37582
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
AF4937
Species: Hu
Applications: WB, IHC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00007541-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for ZFP161 Antibody (H00007541-B01P) (0)

There are no publications for ZFP161 Antibody (H00007541-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP161 Antibody (H00007541-B01P) (0)

There are no reviews for ZFP161 Antibody (H00007541-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZFP161 Antibody (H00007541-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFP161 Products

Bioinformatics Tool for ZFP161 Antibody (H00007541-B01P)

Discover related pathways, diseases and genes to ZFP161 Antibody (H00007541-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP161 Antibody (H00007541-B01P)

Discover more about diseases related to ZFP161 Antibody (H00007541-B01P).
 

Pathways for ZFP161 Antibody (H00007541-B01P)

View related products by pathway.

PTMs for ZFP161 Antibody (H00007541-B01P)

Learn more about PTMs related to ZFP161 Antibody (H00007541-B01P).

Blogs on ZFP161

There are no specific blogs for ZFP161, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFP161 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFP161
Entrez
Uniprot