ZDHHC22 Antibody

Immunocytochemistry/Immunofluorescence: ZDHHC22 Antibody [NBP2-68686] - Staining of human cell line RH-30 shows localization to plasma membrane.

Product Discontinued

ZDHHC22 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GNYVLVIQNSPDDLGACQGASARKTPCPSPSTHFCRVCARVTLRHDHHCFFTGNCIGSRNM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZDHHC22
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Reactivity Notes

Mouse 84%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for ZDHHC22 Antibody

• putative palmitoyltransferase ZDHHC22
• C14orf59
• zinc finger, DHHC-type containing 22

Background

ZDHHC22 is a gene that codes for a multi-pass membrane protein that is 263 amino acids long, with a weight of approximately 29 kDa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZDHHC22