Home » ZDHHC17 » ZDHHC17 Antibodies » ZDHHC17 Antibody

ZDHHC17 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: ZDHHC17 Antibody [NBP2-68744] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunocytochemistry/ Immunofluorescence: ZDHHC17 Antibody [NBP2-68744] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ZDHHC17 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFRCCGLFRPVIVDWTRQYTIEYDQISGSGYQL
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZDHHC17
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
ZDHHC17 Recombinant Protein Antigen (NBP2-68744PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for ZDHHC17 Antibody

  • DHHC-17
  • EC 2.3.1
  • EC 2.3.1.-
  • HIP14HIP-14
  • huntingtin interacting protein 14
  • huntingtin interacting protein 3
  • Huntingtin interacting protein H
  • Huntingtin yeast partner H
  • Huntingtin-interacting protein 14
  • Huntingtin-interacting protein 3
  • Huntingtin-interacting protein H
  • HYPHHIP-3
  • KIAA0946HIP3
  • palmitoyltransferase ZDHHC17
  • Putative MAPK-activating protein PM11
  • Putative NF-kappa-B-activating protein 205
  • Zinc finger DHHC domain-containing protein 17
  • zinc finger, DHHC domain containing 17
  • zinc finger, DHHC-type containing 17

Background

ZDHHC17 / HIP14 is a neuronal palmitoyl transferase. Palmitoylation is critical for trafficking and function of signaling molecules, neurotransmitter receptors, and synaptic scaffolding proteins in neurons. ZDHHC17 also causes cellular transformation. It has been shown that mRNA encoding ZDHHC17 is up-regulated in a number of types of human tumors, thus ZDHHC17 and other PATs (palmitoyl acyltransferases) are potential targets for new anticancer drugs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Huntingtin Antibody
NBP3-13106
Western Blot: Huntingtin Antibody [NBP3-13106] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with Huntingtin antibody (NBP3-13106) diluted at 1:1000.
Immunohistochemistry-Paraffin: Huntingtin Antibody [NBP3-13106] - Huntingtin antibody detects Huntingtin protein at cytoplasm in rat brain by immunohistochemical analysis. Sample: Paraffin-embedded rat brain. Huntingtin antibody (NBP3-13106) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunocytochemistry/Immunofluorescence: Huntingtin Antibody [NBP3-13106] - Huntingtin antibody detects Huntingtin protein at cytoplasm by immunofluorescent analysis. Sample: SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Huntingtin protein stained by Huntingtin antibody (NBP3-13106) diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

SLC6A4/5-HTTLPR/Seroto ...
H00006532-D01P
Flow Cytometry: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Fixed and permeabilized mouse mast cells were stained for 1 hour in 4C then stained with PE secondary and ran on FACS. Image from verified customer review.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in transfected 293T cell line by SLC6A4 polyclonal antibody. Lane 1: SLC6A4 transfected lysate (70.30 KDa). Lane 2: Non-transfected lysate.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in mouse lung.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB
SNAP25 Antibody
NBP1-88769
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in human cell lines U2OS and MCF-7 using anti-SNAP25 antibody. Corresponding SNAP25 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: SNAP25 Antibody [NBP1-88769] - Analysis in control (vector only transfected HEK293T lysate) and SNAP25 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SNAP25 Antibody [NBP1-88769] - Staining of human cerebral cortex shows strong positivity in neuropil.
(4 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
ZDHHC13 Antibody
NBP1-51920
Western Blot: ZDHHC13 Antibody [NBP1-51920] - Analysis of ZDHHC13 in human cerebellum lysate (35ug protein in RIPA buffer) using NBP1-51920 at 0.1ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: ZDHHC13 Antibody [NBP1-51920] - staining of paraffin embedded Human Lung. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
GAD2/GAD65 Antibody
NBP1-33284
Immunocytochemistry/Immunofluorescence: GAD2/GAD65 Antibody [NBP1-33284] - DIV9 rat E18 primary hippocampal neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GAD65 stained by GAD65 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody (NBP2-43559) [11710] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunocytochemistry/Immunofluorescence: GAD2/GAD65 Antibody [NBP1-33284] - Paraformaldehyde-fixed HeLa, using GAD65 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with Red at 1:2500.
Immunohistochemistry-Paraffin: GAD2/GAD65 Antibody [NBP1-33284] - RT2 xenograft. GAD65 antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
GODZ GST (N-Term) Pro ...
H00051304-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
CSP Antibody
NBP1-87974
Western Blot: CSP Antibody [NBP1-87974] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CSP Antibody [NBP1-87974] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: CSP Antibody [NBP1-87974] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Species: Hu
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Paralemmin Antibody
NBP1-87770
Immunohistochemistry-Paraffin: Paralemmin Antibody [NBP1-87770] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
Western Blot: Paralemmin Antibody [NBP1-87770] - Analysis in control (vector only transfected HEK293T lysate) and PALM over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Paralemmin Antibody [NBP1-87770] - Staining of human cell line HEK 293 shows localization to nucleus & plasma membrane. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NRAS Antibody
(6S6F3)
NBP3-16473
Immunocytochemistry/Immunofluorescence: NRAS Antibody (6S6F3) [NBP3-16473] - Immunofluorescence analysis of U-2 OS cells using NRAS Rabbit mAb (NBP3-16473) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Analysis of extracts of various cell lines, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Analysis of extracts of Rat lung, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
HRAS Antibody
NBP2-42864
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HRAS antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-RAS antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-Ras antibody diluted at 1:5000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Control immunolocalization of plasma membrane AMPA receptor subunits (external epitopes) in hippocampal neuronal cultures. H) Immunolabeling of non-permeabilized neuronal cultures with ani-GluA1 (green). (I) Immunolabeling with the postsynaptic marker anti-PSD95 [66] after permeabilization of neuronal cultures. (J) Merging of (H) and (I) showing postsynaptic labeling of GluA1. Scale bar (valid for all images): 10 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0140868), licensed under a CC-BY licence.
(1 Review)
(26 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SLC41A1 Antibody
NBP1-82652
Western Blot: SLC41A1 Antibody [NBP1-82652] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-536
Immunohistochemistry-Paraffin: SLC41A1 Antibody [NBP1-82652] - Staining of human heart muscle shows strong cytoplasmic and nuclear positivity in myocytes.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
NIPA Antibody
NBP1-82564
Immunocytochemistry/Immunofluorescence: NIPA Antibody [NBP1-82564] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nuclear membrane.
Western Blot: NIPA Antibody [NBP1-82564] - Analysis using Anti-ZC3HC1 antibody NBP1-82564 (A) shows similar pattern to independent antibody NBP1-82565 (B).
Immunohistochemistry-Paraffin: NIPA Antibody [NBP1-82564] - Staining of human cerebral cortex.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAGT1 Antibody
NBP2-14214
Immunohistochemistry-Paraffin: MAGT1 Antibody [NBP2-14214] - Staining of human thyroid gland shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: MAGT1 Antibody [NBP2-14214] - Staining of human cervix, uterine shows moderate membranous/cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: MAGT1 Antibody [NBP2-14214] - Staining of human endometrium shows moderate to strong membranous positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
RPL29 Antibody
NBP3-12600
Western Blot: RPL29 Antibody [NBP3-12600] - Lane A: PC-3 Whole Cell LysateLane B: U87-MG Whole Cell LysateLane C: SW480 Whole Cell LysateLysates/proteins at 30 ug per lane.SecondaryGoat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution.Developed using the ECL technique.Performed under reducing conditions.Predicted band size:18 kDaObserved band size:22 kDa
Immunohistochemistry-Paraffin: RPL29 Antibody [NBP3-12600] - Staining of human RPL29 in human brain with rabbit polyclonal antibody at 1:10000 dilution.
Immunohistochemistry-Paraffin: RPL29 Antibody [NBP3-12600] - Staining of human RPL29 in human liver with rabbit polyclonal antibody at 1:10000 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Hip Antibody
[Unconjugated]
AF1568
Hip Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: WB
ZDHHC17 Antibody
NBP2-68744
ZDHHC17 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ZDHHC17 Antibody (NBP2-68744) (0)

There are no publications for ZDHHC17 Antibody (NBP2-68744).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC17 Antibody (NBP2-68744) (0)

There are no reviews for ZDHHC17 Antibody (NBP2-68744). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZDHHC17 Antibody (NBP2-68744) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZDHHC17 Products

Bioinformatics Tool for ZDHHC17 Antibody (NBP2-68744)

Discover related pathways, diseases and genes to ZDHHC17 Antibody (NBP2-68744). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC17 Antibody (NBP2-68744)

Discover more about diseases related to ZDHHC17 Antibody (NBP2-68744).
 

Pathways for ZDHHC17 Antibody (NBP2-68744)

View related products by pathway.

PTMs for ZDHHC17 Antibody (NBP2-68744)

Learn more about PTMs related to ZDHHC17 Antibody (NBP2-68744).
 

Research Areas for ZDHHC17 Antibody (NBP2-68744)

Find related products by research area.

Blogs on ZDHHC17

There are no specific blogs for ZDHHC17, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZDHHC17 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ZDHHC17