ZDHHC17 Antibody


Immunocytochemistry/ Immunofluorescence: ZDHHC17 Antibody [NBP2-68744] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

ZDHHC17 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFRCCGLFRPVIVDWTRQYTIEYDQISGSGYQL
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
ZDHHC17 Recombinant Protein Antigen (NBP2-68744PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for ZDHHC17 Antibody

  • DHHC-17
  • EC 2.3.1
  • EC 2.3.1.-
  • HIP14HIP-14
  • huntingtin interacting protein 14
  • huntingtin interacting protein 3
  • Huntingtin interacting protein H
  • Huntingtin yeast partner H
  • Huntingtin-interacting protein 14
  • Huntingtin-interacting protein 3
  • Huntingtin-interacting protein H
  • KIAA0946HIP3
  • palmitoyltransferase ZDHHC17
  • Putative MAPK-activating protein PM11
  • Putative NF-kappa-B-activating protein 205
  • Zinc finger DHHC domain-containing protein 17
  • zinc finger, DHHC domain containing 17
  • zinc finger, DHHC-type containing 17


ZDHHC17 / HIP14 is a neuronal palmitoyl transferase. Palmitoylation is critical for trafficking and function of signaling molecules, neurotransmitter receptors, and synaptic scaffolding proteins in neurons. ZDHHC17 also causes cellular transformation. It has been shown that mRNA encoding ZDHHC17 is up-regulated in a number of types of human tumors, thus ZDHHC17 and other PATs (palmitoyl acyltransferases) are potential targets for new anticancer drugs.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ZDHHC17 Antibody (NBP2-68744) (0)

There are no publications for ZDHHC17 Antibody (NBP2-68744).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC17 Antibody (NBP2-68744) (0)

There are no reviews for ZDHHC17 Antibody (NBP2-68744). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZDHHC17 Antibody (NBP2-68744) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZDHHC17 Products

Bioinformatics Tool for ZDHHC17 Antibody (NBP2-68744)

Discover related pathways, diseases and genes to ZDHHC17 Antibody (NBP2-68744). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZDHHC17 Antibody (NBP2-68744)

Discover more about diseases related to ZDHHC17 Antibody (NBP2-68744).

Pathways for ZDHHC17 Antibody (NBP2-68744)

View related products by pathway.

PTMs for ZDHHC17 Antibody (NBP2-68744)

Learn more about PTMs related to ZDHHC17 Antibody (NBP2-68744).

Research Areas for ZDHHC17 Antibody (NBP2-68744)

Find related products by research area.

Blogs on ZDHHC17

There are no specific blogs for ZDHHC17, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZDHHC17 Antibody and receive a gift card or discount.


Gene Symbol ZDHHC17