ZCPW1 Antibody

Images

 
Western Blot: ZCPW1 Antibody [NBP1-87997] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: ZCPW1 Antibody [NBP1-87997] - Staining of human cell line U-251 MG shows positivity in golgi apparatus.
Immunohistochemistry-Paraffin: ZCPW1 Antibody [NBP1-87997] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZCPW1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EDRLKKTVQDHSQIRDQQKGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLESDVAYASYIPGSIIWAKQYGYP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZCWPW1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZCPW1 Protein (NBP1-87997PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZCPW1 Antibody

  • DKFZp434N0510
  • FLJ10057
  • ZCW1
  • zinc finger CW-type PWWP domain protein 1
  • zinc finger, CW type with PWWP domain 1
  • zinc finger, CW-type with PWWP domain 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00003851-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for ZCPW1 Antibody (NBP1-87997) (0)

There are no publications for ZCPW1 Antibody (NBP1-87997).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZCPW1 Antibody (NBP1-87997) (0)

There are no reviews for ZCPW1 Antibody (NBP1-87997). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZCPW1 Antibody (NBP1-87997) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZCPW1 Products

Bioinformatics Tool for ZCPW1 Antibody (NBP1-87997)

Discover related pathways, diseases and genes to ZCPW1 Antibody (NBP1-87997). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZCPW1 Antibody (NBP1-87997)

View related products by pathway.

PTMs for ZCPW1 Antibody (NBP1-87997)

Learn more about PTMs related to ZCPW1 Antibody (NBP1-87997).

Blogs on ZCPW1

There are no specific blogs for ZCPW1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZCPW1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZCWPW1