ZC4H2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZC4H2 Antibody [NBP2-13538] - Staining of human cell line PC-3 shows localization to microtubules.
Immunohistochemistry-Paraffin: ZC4H2 Antibody [NBP2-13538] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZC4H2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AQQLQVARKQDTRQTATFRQQPPPMKACLSCHQQIHRNAPICPLCKAKSR SRNPKKPKRKQDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZC4H2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZC4H2 Protein (NBP2-13538PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZC4H2 Antibody

  • HCA127KIAA1166Hepatocellular carcinoma-associated antigen 127
  • zinc finger C4H2 domain-containing protein
  • zinc finger, C4H2 domain containing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-872
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-46836
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31176
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32435
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89594
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-00129
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
35680002
Species: Hu
Applications: WB, ELISA

Publications for ZC4H2 Antibody (NBP2-13538) (0)

There are no publications for ZC4H2 Antibody (NBP2-13538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZC4H2 Antibody (NBP2-13538) (0)

There are no reviews for ZC4H2 Antibody (NBP2-13538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZC4H2 Antibody (NBP2-13538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZC4H2 Products

Bioinformatics Tool for ZC4H2 Antibody (NBP2-13538)

Discover related pathways, diseases and genes to ZC4H2 Antibody (NBP2-13538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZC4H2 Antibody (NBP2-13538)

Discover more about diseases related to ZC4H2 Antibody (NBP2-13538).

Blogs on ZC4H2

There are no specific blogs for ZC4H2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZC4H2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC4H2