ZBTB8B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZBTB8B Antibody [NBP1-90538] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: ZBTB8B Antibody [NBP1-90538] - Staining of human duodenum shows distinct positivity in cytoplasm, membranes and nuclei of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZBTB8B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVECLRESPCGDCGDCHPLELVVRDSLGGGSADSNLSTPPKRIEPKVEFDADEVEVDVGEQLQQYAAPLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB8B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZBTB8B Protein (NBP1-90538PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZBTB8B Antibody

  • DKFZp547H154
  • RP1-27O5.1
  • zinc finger and BTB domain containing 8B
  • zinc finger and BTB domain-containing protein 8B
  • ZNF916B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZBTB8B Antibody (NBP1-90538) (0)

There are no publications for ZBTB8B Antibody (NBP1-90538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBTB8B Antibody (NBP1-90538) (0)

There are no reviews for ZBTB8B Antibody (NBP1-90538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZBTB8B Antibody (NBP1-90538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZBTB8B Products

Bioinformatics Tool for ZBTB8B Antibody (NBP1-90538)

Discover related pathways, diseases and genes to ZBTB8B Antibody (NBP1-90538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZBTB8B

There are no specific blogs for ZBTB8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBTB8B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB8B